Details for Lyrate rockcress Locus 16041125

Position : sca3 ( 5`- 4630127 .. 4636260 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041125

Protein [Map View]
MAVRLQRPGLVSSSSSSKPCLPRMSIVTFISCKKTVHLEYLSNCWSNPRSQLFVRYVFFERSKICRSKNKSQRLVLASAE
DGVAINGSPKPRSSSNLGDMRTNFTGSSQDENSSNGLIQSLHDAARSIELAVREKITPSRFSWFPATWLGADKYAWVKTL
SYQASLYSLLQAVNEISSRGNYRDEDINVFVQRSLSRQAAPLENMMRENLSSKHPKAYEWFWSEQVPSVVTSFVNYIEGD
QRFVAATSVYAKGKSAAASNEIEVSLLMLVLNCIAAITKVGPAKFSCPPFFSMIPDTTGRLMEKLVDFVPLPQAYHSIKS
IGLQREFLTHFGPRAAMCRVNGDIATDEVVFWIDLIQKQLQRAIDREKIWSKLTTSESIEVLERDLAIFGFFIALGRSTQ
SILAANGFDSLENPLEDLVRHLIGGSVLYYPQLSAISSYQLYVEVVCEELEWIPFYPDNTGTQPPKQSHGHKSKTEGPPN
YEVIPQLLDVCSYWLQSFIKYSKWPENPSNVKAAKFLSKGHKTLIRCKEELGILKNASSIVRESNSFDKALESVDEALVR
LESLLQELYVSNSSSGKEQIKAACSDLEKIRKLKKEAEFLEATFRAKAASLQQGGDKNDSQESYKVQKRYFKGKDTKIAI
SSEDQGKSISRGFWGFFVRPPRKKLDPEISGGEYIGKPSGNLLSIDSEPNEISRFEILRNELIELEKRVKRSTDQSVDEE
EIISDDTPQASSRTESVQLVQSPMKENIIEKTLQKLREASTDVWQGTQLLAIDSAAAVQLLRRSLIGDELTEKEKKALRR
TMTDLASVIPIGILMLLPVTAVGHAAMLAGIQRYVPGLIPSTYGSERLNLLRQLEKIKELQTNETETEEGVEEIAL*

DNA
ATGGCAGTTAGACTACAACGACCTGGTCTTGTATCCTCAAGCTCTTCTTCAAAACCATGTCTGCCAAGGATGTCCATTGT
TACTTTCATATCTTGCAAGAAGACGGTACACTTGGAGTACTTATCTAATTGCTGGAGCAATCCCAGGAGCCAATTGTTTG
TGAGATATGTTTTTTTCGAAAGGAGCAAAATTTGTCGTAGCAAGAATAAATCACAGAGGCTGGTCTTGGCATCTGCTGAA
GATGGAGTGGCTATCAATGGAAGTCCTAAGCCAAGATCTAGTAGTAATTTGGGGGACATGAGGACCAATTTCACCGGATC
ATCACAAGATGAAAACAGCTCTAATGGACTTATCCAGTCTTTGCATGATGCTGCTAGATCTATTGAATTGGCAGTTAGAG
AGAAGATTACTCCGTCCAGATTTTCATGGTTTCCTGCGACCTGGCTTGGTGCTGATAAATATGCATGGGTGAAGACTCTT
TCGTATCAGGCTTCTCTGTATTCCTTACTACAAGCAGTAAATGAGATTTCATCTAGAGGCAATTACAGAGACGAGGATAT
TAATGTCTTTGTTCAAAGGAGCTTATCACGCCAAGCTGCTCCCCTTGAGAATATGATGCGAGAGAATCTATCTTCCAAAC
ATCCTAAAGCCTATGAATGGTTTTGGTCCGAGCAAGTTCCTTCAGTGGTGACATCTTTTGTGAATTATATCGAGGGGGAC
CAACGTTTTGTTGCTGCCACTTCTGTCTATGCAAAAGGAAAGTCCGCAGCTGCAAGTAATGAGATTGAGGTGTCACTTCT
CATGCTTGTGCTCAATTGCATTGCAGCAATCACGAAAGTTGGCCCGGCAAAATTTTCCTGCCCGCCCTTCTTCTCTATGA
TTCCAGATACAACTGGAAGATTGATGGAAAAACTTGTAGACTTCGTTCCACTCCCTCAAGCGTATCATTCAATCAAAAGC
ATAGGCCTACAAAGAGAGTTTCTTACTCATTTTGGTCCTCGCGCAGCAATGTGCAGAGTTAATGGTGACATTGCTACAGA
TGAAGTAGTTTTCTGGATCGATCTTATACAGAAACAACTGCAGCGGGCTATAGATAGGGAGAAAATATGGTCAAAGTTAA
CAACATCCGAAAGTATAGAGGTTTTGGAGAGAGATTTAGCAATTTTTGGATTCTTCATTGCTTTGGGCAGGAGCACACAG
TCCATTTTAGCTGCAAATGGTTTTGATTCTCTGGAAAATCCTTTGGAAGACCTTGTTAGGCATCTTATTGGGGGCAGCGT
CCTGTACTATCCTCAACTTTCAGCCATCAGTTCATACCAGCTGTATGTAGAGGTTGTTTGCGAAGAACTAGAATGGATTC
CTTTCTATCCAGACAATACTGGCACACAGCCTCCAAAACAATCACATGGGCATAAGAGCAAAACTGAAGGACCACCTAAT
TATGAAGTTATTCCCCAACTGTTGGATGTTTGCTCTTATTGGCTACAGAGTTTTATTAAATATAGTAAATGGCCAGAGAA
TCCATCTAATGTCAAGGCAGCAAAATTCTTATCCAAGGGGCACAAAACTTTGATTCGGTGTAAAGAAGAACTGGGGATAT
TAAAGAATGCATCATCAATTGTTAGAGAGTCGAACTCATTTGACAAGGCCCTAGAAAGTGTAGATGAAGCCCTCGTGAGA
CTGGAAAGCCTGCTACAGGAGTTGTATGTATCAAACTCATCGTCTGGAAAGGAACAAATAAAAGCCGCTTGCTCTGACCT
AGAGAAAATACGGAAGCTTAAGAAAGAGGCTGAATTTCTGGAGGCAACTTTCAGAGCCAAAGCAGCTTCCTTGCAACAGG
GAGGTGACAAAAATGATTCTCAGGAATCCTATAAGGTACAAAAACGGTATTTTAAAGGGAAAGACACAAAAATCGCAATT
AGTTCTGAGGATCAAGGCAAAAGTATAAGTCGTGGATTCTGGGGATTCTTTGTACGGCCTCCAAGGAAGAAGCTTGATCC
TGAGATATCAGGAGGTGAATATATTGGGAAACCCAGTGGAAACTTACTTAGCATAGACTCAGAACCAAATGAGATCAGCC
GATTCGAAATTCTAAGGAACGAGCTAATAGAACTGGAAAAGCGGGTCAAAAGAAGCACTGATCAGTCAGTAGATGAGGAG
GAAATAATATCTGATGATACTCCTCAAGCAAGCAGTAGAACGGAAAGTGTTCAGTTGGTTCAGTCTCCCATGAAGGAAAA
CATAATTGAGAAAACTCTTCAAAAACTAAGAGAAGCCTCCACGGATGTGTGGCAAGGTACTCAACTTCTTGCCATTGATT
CAGCAGCTGCTGTGCAGCTACTTCGGAGATCTCTGATTGGTGATGAATTAACAGAAAAAGAAAAGAAAGCCCTGCGCAGA
ACCATGACTGACTTGGCATCAGTTATTCCCATCGGTATTCTAATGCTTCTTCCGGTTACAGCGGTTGGTCACGCAGCCAT
GCTGGCTGGAATTCAGAGATATGTACCCGGCCTGATTCCTTCCACATATGGGTCTGAAAGGTTGAACCTATTGAGACAGC
TTGAGAAAATCAAGGAACTGCAAACAAATGAAACTGAGACCGAAGAAGGCGTCGAGGAGATAGCATTATGA