Details for Lyrate rockcress Locus 16041105

Position : sca3 ( 5`- 10061881 .. 10060916 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041105

Protein [Map View]
MSQEDQPKRPQEPVKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAAAVMQSAATANKRGGFVQPGDTTDL
AAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRPVATAAATEAEAVGLSLQSAITIGEALEATVQTAGNKPVDQSDAA
AIQAAEVRASGTNVIAPGGIAASAQSAANHNATVDRDEDKIKLIDVLAGATGKLTADKAVTRQDAEGVVGAELRNNPNLS
THPGGVSASITAAARLNERADI*

DNA
ATGAGTCAAGAAGACCAACCAAAGCGGCCACAAGAGCCAGTCAAATACGGCGACGTTTTTGAAGTCTCCGGTGAACTCGC
TGATAAGCCTATAGCGCCTGAGGATGCAAACATGATGCAAGCCGCGGAGACACGGGTGTTTGGCCACACTCAAAAAGGCG
GTGCAGCTGCCGTCATGCAGTCTGCAGCCACTGCCAACAAACGCGGTGGCTTTGTCCAACCAGGTGACACAACTGACCTG
GCCGCCGAACGAGGTGTCACGGTGGCGCAAACTGACGTCCCTGGTGCACGTGTCACAACAGAATTCGTCGGTGGACAGGT
CGTTGGACAATACGTTGAGCCGAGACCGGTGGCTACTGCTGCAGCTACGGAAGCAGAAGCGGTGGGATTGAGTTTGCAAA
GTGCGATCACAATTGGAGAAGCATTGGAAGCAACTGTGCAAACCGCTGGAAACAAACCGGTAGATCAAAGCGACGCAGCA
GCGATTCAAGCGGCTGAGGTTAGAGCTTCTGGCACTAATGTGATTGCTCCTGGTGGAATCGCCGCTTCAGCTCAATCCGC
AGCGAATCACAATGCTACCGTAGACCGTGATGAGGATAAAATCAAGCTCATTGATGTTTTGGCGGGTGCGACGGGTAAGT
TAACCGCTGATAAAGCTGTAACGAGGCAGGACGCAGAGGGAGTGGTGGGCGCTGAGCTGAGGAACAACCCTAATCTGTCT
ACTCATCCCGGTGGTGTATCGGCTTCTATTACCGCAGCCGCTAGGCTTAACGAGAGAGCTGATATATGA