Details for Lyrate rockcress Locus 16041080

Position : sca5 ( 5`- 17918917 .. 17920050 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16041080

Protein [Map View]
MEEIMSMIFNGINLVKELEFSLSSQESPESDLSSYLSSISTLFGDANERLKILLAWRNSLAQYQPEPEPVPMFDIPMQND
QSLMQDHWFNFRYPVMQTVEGNATSRPRHQRRKKDIGEEETVLAAVERIEIPPDDNYTWRKYGQKEILGSRFPRAYYRCT
HQKLYKCPAKKQVQRLDEDPHTFRITYRSSHTCHSFTTSPISSLAPATATTANVPDVANMAEAMFGNMDSVVPLGKPCFN
HHCLVPGDDGDGEGTHGTHLRRDTTCPS*

DNA
ATGGAGGAGATAATGTCAATGATATTCAACGGAATCAATCTGGTTAAGGAGCTAGAGTTCAGCTTATCATCACAAGAGTC
ACCAGAATCAGATTTGTCGAGTTATCTAAGCTCGATCTCCACTCTATTCGGAGACGCCAACGAGCGGCTGAAAATCCTAC
TTGCGTGGAGGAACTCTTTGGCACAGTACCAGCCTGAACCGGAACCGGTTCCAATGTTTGATATACCGATGCAGAATGAT
CAGAGTCTGATGCAGGACCACTGGTTTAACTTTAGGTATCCAGTGATGCAGACAGTGGAGGGTAATGCTACCTCAAGACC
AAGGCATCAAAGAAGAAAGAAGGATATTGGAGAAGAAGAAACGGTGTTGGCGGCGGTGGAGAGGATCGAGATCCCGCCGG
ACGACAATTACACTTGGCGTAAATACGGTCAGAAGGAAATTCTCGGTTCTAGATTTCCTCGGGCGTACTATAGATGCACC
CACCAGAAACTATACAAGTGTCCGGCGAAGAAGCAAGTGCAACGGCTCGACGAAGATCCTCACACGTTCCGTATCACTTA
CCGCAGTTCACACACGTGTCACTCCTTCACCACTTCCCCGATTTCATCATTAGCACCTGCCACCGCAACAACCGCCAACG
TTCCCGATGTCGCTAACATGGCCGAAGCTATGTTCGGCAACATGGACTCCGTTGTTCCATTAGGCAAACCCTGCTTTAAC
CACCATTGCCTCGTGCCCGGAGACGACGGTGATGGGGAGGGGACACATGGAACTCACCTTCGCAGAGATACGACATGTCC
TAGTTGA