Details for Lyrate rockcress Locus 16041057

Position : sca3 ( 5`- 5058135 .. 5061390 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16041057

Protein [Map View]
MGSADLVDDRTFNGDFSVEGAAKLKEMVMVKLKEFMGDYTDDTLVEYVIVLLRNGRRKEEAKNELKIFLGDDSDSFVAWL
WDHLAESVDEYFSSHVEGTTIKSSLISSQNEDKALVPMDSESERGRSDKSNGARRGRQWRSQPTNVSEIPPLLSSEVHKI
HNYEKKDHKHRHNKRSPSPQSQSHRKRSRTDDSRNEQREAKPDVSRRLLQFAVRDALAISRPVNSSTESSLKRLRSVVST
STQDSSDPDPARKIRSVARVVNPMATVMKAVAEAAEDAKKPRSGRSVFDRISHSTGFSETLDQHMVHGEVSPKNEESRNF
SEDQEAVQLQYTQSLDNNGVYVEKMTTYDTGLQPAFSSDRGRLGSSVNVSHPSTFLGNRINNPNSLQHRLVDDSKRLTGS
NYQNRLTEVDTKHKTASFSGNVDTGKTVSLEEQMKVPDVGLQRYMDEGRLVSSEANNQLSTQKILSDTIRNGNIKPAANV
KEDSTTNKSVPGTLSTTRPLEDASSRTIFVANVHFGATKDSLSRHFNKCGEVLKATIVTDPATGQPSGSAYIEFTRKEAA
ENALSLDGTSFMSRILKIVKGSNGQQQEAASSMTWPRGGRFARAPSYFRGGAVRGRSVVRGGARSMQWKRDSADTGNNNN
VAPNNARSLTYVRTESKSDGIAND*

DNA
ATGGGAAGCGCCGATCTAGTCGATGATCGGACCTTCAATGGTGATTTCAGTGTGGAAGGAGCTGCCAAGTTGAAAGAGAT
GGTCATGGTTAAACTCAAGGAGTTTATGGGCGATTACACGGATGACACTCTAGTGGAATATGTGATAGTCCTTCTTAGAA
ATGGGAGAAGAAAAGAGGAAGCAAAGAATGAATTGAAAATATTTCTTGGAGATGATAGCGACTCTTTTGTAGCCTGGTTG
TGGGATCATCTGGCTGAGAGTGTAGATGAATACTTTAGTTCTCATGTGGAGGGAACTACCATAAAAAGCTCATTGATAAG
CAGTCAGAATGAGGATAAAGCACTTGTGCCTATGGATTCTGAATCTGAAAGGGGACGATCTGATAAATCAAATGGTGCAC
GCCGCGGTAGACAATGGAGAAGCCAGCCAACTAATGTCTCTGAGATTCCTCCTCTTCTGAGCTCTGAGGTTCACAAAATT
CATAACTACGAGAAGAAAGATCACAAACACCGACATAATAAAAGGTCTCCATCTCCGCAGTCTCAATCTCACAGGAAAAG
GTCTAGAACTGATGACTCACGGAATGAACAGAGAGAAGCTAAACCTGATGTCTCTCGCCGGCTGCTTCAGTTTGCTGTGC
GAGATGCTCTAGCTATATCAAGGCCGGTAAATAGTTCGACTGAATCCTCATTAAAACGTCTTCGTTCAGTGGTGTCCACA
TCTACTCAAGACTCATCTGACCCCGATCCAGCTCGGAAAATTCGATCGGTTGCAAGAGTTGTGAACCCCATGGCAACTGT
TATGAAAGCTGTCGCCGAAGCAGCTGAAGATGCCAAGAAACCAAGATCTGGGAGAAGTGTCTTTGACAGAATTAGTCATT
CTACTGGATTTTCAGAGACCCTGGACCAGCATATGGTACATGGTGAAGTTTCCCCCAAGAATGAAGAATCTAGGAATTTT
AGCGAAGACCAGGAAGCGGTACAGCTTCAATACACGCAGAGTCTTGACAACAATGGAGTGTATGTTGAGAAAATGACAAC
TTATGACACTGGCTTGCAGCCAGCTTTTTCGTCTGATCGAGGCAGACTCGGTTCAAGTGTTAACGTTTCTCATCCAAGTA
CTTTTCTTGGGAACAGAATTAACAATCCAAATAGTCTGCAGCATCGTTTGGTCGATGACTCCAAAAGACTTACAGGGTCG
AATTATCAAAATCGCCTTACTGAAGTTGATACTAAGCATAAGACTGCAAGTTTCTCTGGCAATGTAGATACAGGGAAAAC
GGTAAGTTTAGAGGAGCAGATGAAAGTACCAGATGTGGGTCTGCAAAGATATATGGACGAAGGCAGATTAGTTTCTAGTG
AAGCTAACAATCAATTATCGACGCAGAAAATCTTGAGTGATACAATAAGGAATGGAAATATAAAACCTGCTGCCAATGTG
AAAGAAGATTCAACGACCAATAAATCTGTTCCTGGGACATTATCCACTACCCGCCCTTTGGAAGATGCGAGTTCTCGAAC
AATCTTTGTCGCCAATGTTCATTTTGGTGCCACCAAGGATAGCCTTTCAAGGCATTTTAACAAGTGTGGTGAAGTGCTTA
AAGCTACCATAGTTACAGATCCAGCAACAGGACAACCAAGTGGATCAGCGTACATTGAGTTCACGCGTAAAGAAGCTGCA
GAGAATGCATTGTCTCTGGACGGTACCTCTTTCATGTCTCGGATTCTCAAGATTGTGAAAGGAAGCAATGGGCAACAGCA
AGAGGCTGCATCGAGCATGACATGGCCTCGAGGTGGAAGGTTCGCAAGAGCGCCCTCATACTTTAGAGGTGGTGCAGTTA
GGGGTCGTTCTGTTGTTAGAGGTGGAGCCAGGAGTATGCAATGGAAGCGTGATTCAGCTGACACTGGAAACAACAACAAT
GTAGCTCCCAACAATGCTCGTAGCCTCACGTATGTCCGAACAGAATCAAAATCAGACGGAATTGCCAACGATTGA