Details for Lyrate rockcress Locus 16040982

Position : sca3 ( 5`- 12656476 .. 12658111 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040982

Protein [Map View]
MASNVQLSETSSPRSQKNCPRVEKEEVDYMQRAQWLRAALLGANDGLVTVASLMMGVGSIKEDVKAMLLVGFAGLVAGAC
SMAIGEFVSVCTQRDIETAQMKRAIENKTSLSEIDEQEEEEKKERLPNPGQAAIASALAFSVGAAMPLLAAVFIENHKVR
MVVVAIVATIALVVFGVTGAVLGKTSVAKSSVRVVIGGWMAMALTFGLTKFIGSAAMQI*

DNA
ATGGCTTCCAACGTTCAGCTTTCAGAAACAAGCAGCCCAAGGAGTCAGAAAAACTGTCCGAGAGTAGAGAAGGAGGAAGT
GGACTACATGCAGAGAGCTCAGTGGCTAAGAGCTGCCTTGCTCGGAGCCAACGATGGTCTGGTCACAGTTGCTTCGCTAA
TGATGGGTGTTGGTTCTATCAAAGAAGACGTCAAAGCAATGCTTCTTGTTGGTTTTGCCGGCCTTGTAGCGGGTGCTTGT
AGTATGGCTATTGGAGAGTTTGTGTCTGTATGCACCCAAAGGGATATTGAAACTGCGCAGATGAAGAGAGCTATTGAGAA
TAAGACATCATTATCAGAAATCGACGAACAAGAGGAGGAGGAGAAGAAAGAACGGCTGCCAAATCCAGGGCAAGCAGCAA
TTGCATCAGCGTTAGCGTTTTCTGTGGGTGCAGCAATGCCGCTTTTGGCCGCTGTATTCATAGAGAATCATAAGGTAAGA
ATGGTTGTGGTAGCGATTGTGGCCACCATAGCATTAGTTGTGTTTGGAGTGACCGGTGCGGTCTTGGGAAAGACAAGTGT
GGCTAAGTCGAGCGTTAGAGTGGTGATTGGTGGTTGGATGGCTATGGCTCTTACCTTTGGTCTCACTAAGTTCATTGGCT
CCGCAGCCATGCAAATTTAG