Details for Lyrate rockcress Locus 16040976

Position : sca3 ( 5`- 3780689 .. 3778669 -3` )
Annotation : [B2G] pectate lyase family protein
External links : CoGe
PGDD synteny : 16040976

Protein [Map View]
MGNLHGLHRSHHGGSNFPGESPNSPFPPPYTSAPPFDHHMTVGPYCHVDSSLRSLAGKAEGFGRAAVGGLNGPICHVTSL
ADEGPGSLREACKRPEPLWIVFDVSGTINLSSFVSVSSHTTVDGRGQKVKITGKGLRLKECENVIICNLEFEGGVGPDAD
AIQIKPKSHNIWIDRCSLKNYYDGLIDITRESTDITVSRCHFMNHNKTMLIGADTSHVTDRCIRVTIHHCFFDGTRQRHP
RVRFAKVHLFNNYTRHWAIYAVGAGVESQIYSQCNIYEASEKKTVFKYITEKAADKEKPGAGFVRSEGDLLLNGAKSCLS
QGGERYVFSPTQHYSEWTVESPTEILKNYLKHSTGWQNIPLPLDQPPTTG*

DNA
ATGGGAAACTTACATGGCCTTCACAGATCCCATCACGGCGGTTCTAATTTTCCCGGTGAATCCCCCAATTCACCTTTCCC
ACCACCATATACATCAGCTCCGCCATTCGATCACCACATGACGGTGGGACCTTATTGCCACGTAGACTCCAGCCTCCGCT
CTCTCGCTGGTAAGGCTGAGGGTTTCGGCCGCGCCGCCGTTGGTGGTCTAAATGGTCCGATTTGCCACGTCACTTCTTTA
GCTGACGAGGGTCCAGGATCGTTGCGAGAGGCTTGTAAGAGGCCAGAACCGTTATGGATTGTGTTCGATGTATCGGGAAC
GATCAATCTGTCTTCGTTTGTGAGTGTATCATCGCACACAACGGTGGACGGAAGAGGACAAAAGGTGAAGATAACGGGAA
AAGGGTTAAGGCTAAAAGAGTGTGAAAACGTTATAATCTGCAATCTTGAATTTGAAGGCGGTGTGGGACCAGACGCAGAC
GCAATTCAGATCAAACCAAAATCACACAACATTTGGATTGATCGGTGTAGTCTCAAGAATTACTATGATGGTTTGATCGA
TATCACACGAGAAAGCACTGACATTACTGTCTCAAGATGCCATTTCATGAACCACAACAAGACGATGTTAATAGGAGCGG
ACACAAGTCACGTTACGGACCGATGCATAAGAGTTACGATACATCACTGTTTTTTCGACGGCACACGTCAGCGACACCCT
CGCGTTCGCTTCGCAAAAGTCCATCTCTTCAATAACTACACTCGTCATTGGGCCATTTACGCTGTCGGTGCCGGTGTAGA
ATCTCAGATATATTCTCAGTGCAACATATATGAAGCTAGTGAAAAGAAAACTGTCTTTAAGTACATCACTGAGAAGGCGG
CGGATAAAGAGAAACCCGGAGCTGGGTTCGTACGGTCAGAAGGGGATTTGTTGTTGAACGGAGCCAAGTCGTGTCTTAGC
CAGGGCGGAGAGCGGTATGTGTTCTCTCCGACCCAACACTATTCCGAATGGACTGTCGAATCTCCAACCGAGATACTCAA
GAACTATCTGAAACACTCGACCGGATGGCAGAACATTCCGCTCCCACTAGACCAACCTCCTACCACCGGTTAA