Details for Lyrate rockcress Locus 16040946

Position : sca3 ( 5`- 714956 .. 713759 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040946

Protein [Map View]
MGFLSNKISRDDVKPGDHIYSWRQAYIYAHHGIYVGDGQVNHFTRGDGQETGTGTFLDNIIVSSSHNHGDNPCPNCGDRS
NLGGVISSCLECFLAGGDLYVFEYSVSPAIFLAKPRGGVCTIASSDPPEEVIYRANFLLQNGFGVYNVFKNNCEDFAIYC
KTGLLVANTDVGRSGQAASIVAAASVLLSSPLRFVAGFGGLAVAGYGMYCTSRLVSDIGMRWDVSKVPVERLVADVERLV
ADVADKSEMEAKSEEKKTTNPKLLTPVLP*

DNA
ATGGGTTTCCTTTCCAACAAAATCTCCAGAGACGATGTGAAACCAGGCGATCACATCTATTCATGGCGTCAGGCCTATAT
CTACGCTCATCACGGAATCTATGTAGGTGATGGACAAGTCAACCATTTTACTCGTGGTGATGGTCAAGAGACTGGAACTG
GGACTTTCTTGGACAATATCATTGTTAGTTCATCCCATAATCATGGAGACAACCCTTGTCCTAATTGTGGAGATCGATCC
AATCTTGGCGGTGTCATCTCTTCCTGCCTTGAATGTTTCCTTGCTGGAGGTGATCTCTATGTCTTTGAGTACAGTGTTTC
CCCTGCTATTTTTCTTGCTAAACCTCGAGGCGGCGTATGCACAATAGCATCTTCAGATCCTCCTGAAGAAGTCATTTACC
GTGCAAACTTTCTCTTGCAAAATGGTTTTGGTGTGTACAATGTTTTTAAGAACAACTGTGAAGATTTTGCCATCTATTGT
AAAACTGGTTTGCTAGTGGCAAACACCGACGTGGGGAGGAGCGGTCAAGCCGCTTCCATTGTTGCAGCTGCCAGTGTTCT
TCTTTCTTCGCCACTCAGGTTTGTAGCAGGTTTTGGTGGTTTGGCTGTTGCTGGATATGGCATGTACTGCACCAGTCGCC
TGGTTTCAGATATAGGCATGCGATGGGATGTGAGCAAGGTGCCTGTTGAGAGACTAGTTGCTGATGTGGAGAGACTAGTT
GCTGACGTGGCTGATAAGTCGGAGATGGAAGCTAAATCAGAAGAGAAGAAGACCACTAATCCAAAACTGCTCACACCTGT
ATTACCATAA