Details for Lyrate rockcress Locus 16040926

Position : sca3 ( 5`- 8332256 .. 8329255 -3` )
Annotation : [B2G] kinase family protein
External links : CoGe
PGDD synteny : 16040926

Protein [Map View]
MVVVYKQALLLAFFAFLGFQYLPLLSEAGCPLDFTSSNFTLVASVCSNNTDRARCCRYMNAFVAVSVARYANYTADLGVT
SDLTEICITTISRTMELYGIPRNATIFCGLGTKILVNYDCEGLATVPPMLHSTSFGDVSRNCKLPLPPGDQCRNCLNSSI
TYLRSLVGADNSIKLSTCRDATYAVLASRVDNSSALELASCFFNVPELSPASGSSPSSLSPEASPPVLADSPSSDNLVLS
PLKSHHRYHLTMVPTIGIAVSAVALVMLVFLIVLIQRKKRELDDSKGMDCNLKRTSPSPHPRSMIHEGDSSGFRKFSYKE
IRKATEDFNTVIGRGGFGTVYKAEFSNGLVAAVKRMNKSSEQAEDEFCREIELLARLHHRHLVALKGFCNKKNERFLVYE
YMENGSLKDHLHSTEKPPLSWETRMKIAIDVANALEYLHFYCDPPLCHRDIKSGNILLDENFVAKLADFGLAHASRDGSI
CFEPVNTDIRGTPGYVDPEYVVTQELTEKSDVYSYGVVLLEIITGKRAVDEGRNLVELCQPLLVSESRRIDLVDPRIKDC
IDGEQLETLVAVVRWCTEKEGVARPSIKQVLRLLYESCDPLHLGLAMAVEENKGRSLRGDSGFQSGDIRGLASSSSTTSR
SHCSRSFLLETGSPHSPPNGLSF*

DNA
ATGGTGGTGGTTTATAAGCAAGCTCTCTTGCTCGCATTCTTCGCATTTCTTGGATTCCAGTACTTGCCTTTACTCTCCGA
AGCAGGTTGTCCATTGGACTTTACTTCATCTAACTTCACTCTAGTGGCTTCCGTGTGCTCGAACAATACCGATAGAGCTA
GATGCTGCCGCTACATGAATGCTTTCGTTGCAGTATCTGTCGCCCGCTATGCGAACTACACAGCTGATCTTGGAGTTACA
TCAGATTTAACTGAAATCTGCATTACTACTATCTCTAGAACCATGGAGCTTTATGGAATCCCAAGAAATGCTACCATCTT
CTGTGGATTAGGGACCAAGATTCTTGTTAACTACGATTGCGAGGGTCTGGCCACTGTACCGCCGATGCTTCATTCCACAA
GTTTTGGAGATGTTTCTAGAAACTGCAAACTTCCGCTTCCACCGGGTGATCAATGTAGGAATTGCTTGAATTCCAGTATC
ACCTACCTTCGTAGCCTCGTTGGTGCAGATAATAGCATCAAACTGAGTACTTGTCGTGATGCAACTTATGCTGTGTTAGC
AAGCCGGGTTGACAATTCATCTGCTCTTGAACTCGCTAGCTGCTTCTTTAATGTGCCTGAGCTTAGCCCCGCTTCAGGTT
CGTCTCCATCATCGCTGAGCCCAGAAGCTTCTCCTCCAGTGTTAGCTGATAGTCCAAGCAGCGACAATCTTGTTTTGTCT
CCATTAAAAAGTCACCATCGATATCACTTGACAATGGTTCCGACTATTGGGATCGCTGTTTCAGCTGTTGCTCTTGTGAT
GCTCGTATTCCTAATAGTTCTTATCCAAAGAAAAAAACGAGAACTTGATGACTCCAAGGGCATGGATTGTAATCTTAAAA
GGACATCTCCTTCTCCCCACCCAAGGTCGATGATTCATGAAGGTGATTCGTCTGGTTTTCGGAAATTCAGCTACAAGGAG
ATAAGGAAAGCAACTGAAGATTTCAACACAGTGATTGGCCGTGGGGGCTTTGGGACTGTTTACAAAGCTGAGTTCAGTAA
TGGGTTGGTTGCAGCTGTAAAAAGGATGAACAAGAGCTCTGAACAAGCAGAAGATGAATTTTGCAGAGAGATAGAGCTTC
TCGCCAGGCTGCATCACCGTCACCTAGTTGCTTTGAAAGGGTTTTGTAACAAGAAGAACGAGAGGTTCCTTGTCTACGAG
TATATGGAAAATGGGAGCCTGAAGGATCATCTACACTCCACGGAAAAACCTCCACTTAGTTGGGAAACAAGGATGAAAAT
CGCAATCGATGTGGCTAATGCTCTGGAATACCTTCATTTCTACTGTGACCCTCCTCTCTGTCACAGAGACATTAAGTCAG
GCAACATATTACTCGACGAGAACTTTGTTGCTAAGCTTGCAGATTTTGGCCTTGCACATGCTTCTAGAGATGGCTCCATT
TGTTTTGAACCTGTTAATACCGATATCCGTGGAACTCCAGGCTATGTAGATCCAGAGTACGTTGTAACACAAGAACTGAC
AGAGAAAAGCGATGTGTACAGCTACGGAGTGGTGTTGCTAGAGATCATAACTGGGAAAAGAGCGGTTGATGAAGGTAGGA
ACCTGGTAGAATTGTGTCAGCCTTTACTGGTATCAGAATCAAGACGCATAGATCTGGTGGATCCGAGAATCAAAGACTGC
ATAGATGGAGAACAGCTTGAAACATTAGTGGCAGTTGTAAGATGGTGCACAGAGAAAGAAGGCGTGGCTAGGCCATCGAT
CAAGCAAGTCCTGAGGCTGTTGTACGAAAGCTGTGATCCATTGCATCTCGGGCTTGCAATGGCGGTCGAGGAGAACAAAG
GACGGTCACTGAGAGGTGACTCAGGGTTTCAAAGTGGAGACATCCGTGGCTTGGCTTCTTCCTCTAGTACGACTTCAAGG
TCGCATTGTAGCCGGAGTTTTCTGCTTGAGACTGGTTCCCCTCACTCTCCACCAAATGGTCTCTCTTTTTGA