Details for Lyrate rockcress Locus 16040924

Position : sca3 ( 5`- 580345 .. 581395 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040924

Protein [Map View]
MEEKDSESEKEAGLLCNDDEEYQFGGSVPKFQFRVGSSKARWIAELGMAEVELKRGKLWTTTGIIRTGKTYCFIEEALYL
SEIGELQLLGDEDDVVISLKDLYREIAEGKCGCCWEDYEVYRYLKGLGYILGRHGVPWTTKDVVNTTPSDEDESLCAGEF
SQDKDSITKRLSDMQICDARPVFDVYLPNSHFKKSSPGEPSFVACFSGDSPPSKEEIEVLQKRVASPLMFCHIVEGRASF
FSFNSIDLLVLP*

DNA
ATGGAGGAGAAGGACTCGGAAAGCGAAAAAGAAGCTGGTTTACTATGCAATGATGACGAAGAATATCAATTTGGTGGTTC
AGTGCCCAAATTTCAATTCAGAGTAGGATCTTCCAAGGCTCGTTGGATTGCTGAATTAGGAATGGCCGAAGTTGAGCTCA
AAAGGGGGAAACTTTGGACGACAACTGGAATTATCCGTACCGGAAAAACATATTGCTTCATAGAGGAGGCTCTGTATTTG
AGTGAAATTGGAGAGTTGCAGCTCTTGGGTGATGAGGATGACGTAGTGATCTCACTGAAGGACTTGTATAGGGAGATTGC
AGAGGGAAAATGTGGCTGCTGTTGGGAAGACTACGAGGTTTATAGATACTTAAAGGGTCTAGGTTACATTCTAGGCAGGC
ATGGAGTTCCTTGGACTACAAAAGATGTTGTGAATACTACACCAAGTGATGAAGATGAGTCACTTTGTGCTGGAGAATTT
TCTCAAGACAAAGACTCTATTACCAAACGCCTGAGTGATATGCAGATCTGTGATGCAAGACCGGTGTTTGATGTGTATTT
GCCAAACAGCCACTTCAAGAAGTCTTCTCCTGGTGAACCGAGCTTTGTCGCTTGCTTCTCGGGAGACTCTCCACCAAGTA
AAGAAGAAATTGAAGTCCTGCAAAAGCGTGTAGCTTCACCATTGATGTTCTGTCATATCGTTGAAGGCCGTGCCAGTTTC
TTTTCCTTCAATTCCATAGACCTCCTTGTCTTACCATAA