Details for Lyrate rockcress Locus 16040920

Position : sca3 ( 5`- 9518434 .. 9520933 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040920

Protein [Map View]
MQYLSYSRRIARVALMETDVRFVYNASHVVQRPSHRSLSHSAFPGKMDTCNQLYAQSPMTGLMMLRANFTSETKHVENPT
EAVKELHGKILDSVNVKRSMAPNAWLWSLIENCRNEDDISFLFEVLQNLRRFRLSNLRIHDNFNCNLCQHVAKTCVRVGT
INHGKRALWKHNVHGLTPSVASAHHLLSYALEHKDAKLMDEVMKLLKMNNLPLQPGTADFVFRICHDTDNWDLLAKYSKK
FCKAGVKLRKTTFDVWMEFAAKRGDTESLWNVDKLRSETYTQHTLSGAFSCAKGFLLEHKPEEAAAVIQIICQAYPDEKK
SAFEAEFKKLVNEWPVDIIKHQNEEDKKAVAASLKSDIPAMVNALVNSGLRVRVDLDELNKNEALLI*

DNA
ATGCAATATCTATCGTACTCTCGTAGAATCGCTAGGGTGGCTCTCATGGAGACCGATGTGAGATTTGTATACAATGCCTC
TCATGTTGTTCAACGGCCGAGCCATCGATCTCTTTCCCACTCTGCATTTCCAGGAAAAATGGATACTTGTAATCAGTTGT
ACGCTCAATCACCTATGACGGGGTTGATGATGCTGAGAGCTAACTTTACCTCTGAAACAAAACATGTCGAGAATCCTACA
GAGGCTGTCAAGGAATTACATGGTAAAATACTTGATTCTGTGAATGTCAAGAGATCAATGGCTCCAAATGCTTGGTTGTG
GTCATTGATTGAGAACTGTCGGAACGAGGATGACATTAGTTTTCTGTTTGAGGTTCTGCAGAATCTCCGGAGATTTAGAT
TGTCCAATCTTCGTATTCATGACAACTTTAATTGCAATCTATGCCAGCATGTTGCTAAGACTTGTGTACGTGTGGGTACA
ATTAACCATGGTAAAAGGGCTCTTTGGAAACATAATGTTCACGGGCTGACTCCGAGCGTTGCATCTGCACACCATTTACT
GTCATACGCATTAGAGCACAAGGACGCGAAACTCATGGATGAAGTAATGAAACTCCTGAAAATGAATAATCTGCCTTTAC
AACCTGGGACAGCGGATTTTGTTTTCAGGATCTGTCATGATACAGATAACTGGGATCTATTAGCTAAGTACTCGAAGAAA
TTCTGCAAAGCTGGAGTCAAGCTCAGGAAGACCACATTTGATGTCTGGATGGAATTTGCTGCCAAAAGAGGAGACACAGA
GTCGTTATGGAATGTTGATAAACTGAGATCTGAGACTTACACTCAACACACCCTTTCCGGTGCTTTTTCATGTGCAAAGG
GCTTTCTGCTAGAACATAAACCTGAAGAAGCTGCTGCTGTAATCCAAATCATCTGTCAGGCGTATCCTGATGAGAAGAAG
TCAGCATTTGAGGCTGAATTCAAGAAGCTGGTAAACGAGTGGCCTGTGGACATTATCAAGCACCAAAATGAAGAAGACAA
GAAGGCTGTAGCTGCATCACTGAAATCTGACATCCCTGCAATGGTCAATGCTTTGGTAAACTCTGGTTTGAGAGTGAGAG
TGGATTTAGATGAGTTAAACAAGAATGAAGCTCTTCTCATCTGA