Details for Lyrate rockcress Locus 16040854

Position : sca3 ( 5`- 7064844 .. 7063583 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040854

Protein [Map View]
MLVYTDLLTGDELLSDSFPYKEIENGILWEVEGKWVTLGAVDVNIGANPSAEEGGEDEGVDDSAQKVVDIVDTFRLQEQP
TYDKKGFVAYIKKYIKSLTPKLNEEQQESFKKGIEGATKYLLPKLKDLQFFVGESMHDDSSLVFAYYKDGATNPTFLYFA
HGLKEVKC*

DNA
ATGTTGGTGTACACAGATCTTCTCACCGGTGATGAGCTTCTGTCTGACTCTTTCCCTTACAAGGAGATTGAGAATGGAAT
TCTTTGGGAAGTAGAAGGAAAGTGGGTTACTCTGGGAGCTGTAGATGTTAACATTGGTGCCAATCCATCTGCTGAAGAAG
GTGGTGAGGATGAGGGTGTTGATGACTCTGCTCAAAAGGTTGTTGACATTGTCGACACCTTCAGACTTCAGGAGCAACCA
ACTTATGACAAGAAGGGATTCGTCGCTTATATTAAGAAATACATCAAGTCGTTGACACCCAAGCTCAACGAAGAACAGCA
GGAATCCTTCAAGAAGGGCATTGAGGGAGCTACCAAGTACCTTCTCCCCAAGCTCAAAGACCTCCAATTCTTTGTTGGGG
AGTCAATGCACGATGACAGCTCTTTGGTCTTTGCCTACTACAAGGATGGTGCAACTAACCCAACATTTTTGTACTTCGCA
CATGGTTTGAAGGAGGTCAAGTGCTGA