Details for Lyrate rockcress Locus 16040844

Position : sca3 ( 5`- 6984229 .. 6983399 -3` )
Annotation : [B2G] legume lectin family protein
External links : CoGe
PGDD synteny : 16040844

Protein [Map View]
MQIHKLCFLVLFLANAAFAVKFNFKSFDGNNLLFLGDAELGPSSDGVSRSGALSMTRDENPFSHGQGLYINQIPFKPSNT
SSPYSFETSFTFSITPRTKPNSGQGLAFIIVAEADNSGASGGGYLGILNKTNDGKPENHILAIEFDTFQNKEFLDISGNH
VGVNINSMTSLVAEKAGYWVQTRVGKRKVWSFKDVNLSSGERFKAWVEFRNKDSTITVTLAPENVKKPKRALIEAPRVLN
EVLLQNMYAGFAGSMGRAVERHDIWSWSFENAAKNN*

DNA
ATGCAGATTCACAAACTCTGTTTTCTTGTTCTGTTCTTAGCTAACGCAGCTTTTGCCGTCAAATTCAACTTCAAATCCTT
CGATGGCAACAACTTGCTATTCCTAGGAGACGCAGAGCTTGGTCCTTCCTCTGATGGTGTAAGCCGATCCGGAGCTTTAT
CCATGACCCGAGACGAGAACCCATTCTCTCATGGTCAAGGTCTTTACATCAATCAAATCCCATTCAAACCTTCAAACACT
TCTTCTCCTTATTCATTTGAAACTTCTTTCACTTTCTCCATCACTCCTCGCACCAAACCTAACTCCGGTCAAGGTCTCGC
CTTCATCATAGTCGCGGAAGCTGATAACTCCGGTGCTTCGGGTGGCGGATATCTCGGAATCCTCAACAAAACCAACGATG
GAAAGCCAGAGAACCACATCTTGGCTATCGAATTCGATACTTTCCAGAACAAAGAGTTTCTAGACATTAGTGGTAACCAT
GTCGGAGTTAACATCAACTCGATGACTTCTCTTGTCGCTGAGAAAGCTGGTTACTGGGTTCAGACAAGAGTCGGTAAAAG
GAAAGTTTGGTCGTTTAAAGATGTGAATCTTAGCAGTGGAGAGAGGTTCAAGGCTTGGGTTGAGTTCAGAAACAAAGACT
CAACGATTACGGTTACACTCGCGCCTGAAAACGTTAAGAAACCTAAGAGGGCTTTGATCGAAGCTCCGAGAGTGCTCAAT
GAAGTTCTTCTTCAAAACATGTACGCTGGTTTTGCTGGTTCCATGGGACGTGCCGTTGAGCGTCACGACATTTGGAGCTG
GTCGTTTGAAAACGCCGCCAAAAACAACTAA