Details for Lyrate rockcress Locus 16040833

Position : sca3 ( 5`- 3946352 .. 3947804 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478323 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16040833

Protein [Map View]
MPQKPRTVICVGDIHGNISLLNKLWLNLQSDIEQSDFNSALVIFLGDYCDRGPETKKVIDFLISLPEKHPEQTADPCLSC
RKPRLCFCWVLGFDTWKEYSKSEEREGWYKGEGFEDMHLQSRRWAGKIRDQFDYSAYGVLYNGSIYDAASTFESYGVPHG
SSDLINAVSESHKKFLTNMVWVHEEEDVCIETEKGLKHCKLIAVHAGLEKGNNVEEQLKLLRAKDTSIPRIQHEPLTGRK
TVWDIPRELDDKQTLIVSGHHGKLHIDGLRLIIDEGGGYADKPLAAIVLPSKKIIRDTDNFSN*

DNA
ATGCCCCAAAAACCACGAACTGTGATCTGTGTCGGAGACATCCATGGAAACATATCACTGCTTAATAAACTCTGGCTTAA
TCTTCAATCCGACATCGAACAATCAGATTTCAACTCAGCTCTCGTCATCTTCCTCGGCGATTACTGCGATCGTGGACCGG
AGACTAAAAAAGTCATCGACTTCTTGATCTCTTTGCCGGAGAAACATCCCGAGCAGACTGCAGACCCATGTCTTTCTTGC
CGGAAACCACGACTTTGCTTTTGCTGGGTTCTTGGGTTTGATACATGGAAGGAGTACTCAAAAAGTGAGGAGAGAGAAGG
ATGGTATAAAGGTGAAGGGTTTGAGGATATGCATCTCCAAAGTAGGAGATGGGCGGGAAAGATTAGGGATCAGTTCGATT
ATTCCGCATATGGAGTGTTGTATAATGGATCGATATACGATGCTGCCTCGACTTTTGAATCCTATGGCGTTCCTCATGGA
TCTTCTGATTTGATAAATGCAGTATCTGAGAGTCACAAGAAGTTCTTGACCAATATGGTATGGGTCCATGAAGAGGAAGA
TGTTTGTATAGAAACAGAGAAAGGGCTTAAGCATTGTAAGTTGATAGCTGTACATGCTGGTTTAGAGAAAGGGAATAACG
TAGAAGAACAGCTTAAACTATTGAGAGCTAAAGACACAAGCATTCCAAGGATACAACATGAACCTCTAACTGGTCGGAAA
ACCGTTTGGGACATCCCACGGGAACTAGATGATAAACAGACTCTTATAGTTAGCGGCCACCACGGGAAACTTCACATTGA
TGGCTTGAGATTGATCATCGATGAAGGCGGTGGATACGCCGATAAACCCTTGGCTGCAATTGTTCTTCCTTCTAAGAAGA
TTATCCGCGACACCGATAATTTTTCTAATTAA