Details for Lyrate rockcress Locus 16040822

Position : sca3 ( 5`- 4613230 .. 4612125 -3` )
Annotation : [B2G] 40s ribosomal protein s14
External links : CoGe
PGDD synteny : 16040822

Protein [Map View]
MSKRKTKEPKVENVTLGPAVREGEQVFGVVHIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDV
AQRCKELGITAIHVKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDVTPIPTDSTRRKGGRRGRRL*

DNA
ATGTCGAAGAGAAAGACTAAAGAGCCAAAGGTTGAGAATGTGACTCTTGGACCTGCTGTTCGTGAAGGAGAGCAAGTTTT
CGGTGTTGTTCACATCTTTGCTTCTTTCAATGATACTTTCATTCATGTGACTGATCTCTCCGGCAGAGAAACTCTTGTTC
GCATCACCGGTGGCATGAAGGTGAAGGCTGATCGTGATGAGTCCTCTCCTTATGCTGCTATGCTTGCAGCTCAAGATGTT
GCTCAAAGATGCAAGGAGCTTGGCATCACAGCCATTCACGTGAAGCTCCGTGCTACTGGAGGAAACAAAACCAAGACTCC
AGGTCCTGGTGCTCAGTCTGCTCTCAGAGCCCTTGCTCGTTCTGGCATGAAGATTGGTCGTATAGAGGATGTGACTCCGA
TTCCCACAGACAGTACACGCCGAAAGGGTGGACGAAGAGGAAGAAGACTGTGA