Details for Lyrate rockcress Locus 16040811

Position : sca3 ( 5`- 2800409 .. 2802105 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040811

Protein [Map View]
MEGCEASASSLAGFTGRRRRSALPRRPRHIKGSAHSFKFLPPSTQANTNSLCGSVSENKLKLKLKLGGGVTRTLQTNSEA
GLYSKALDNGQKPFQNKVKGNSHVQKTLFLGDIHQSRGYPSVTGNRISMSEKSKRGLKKRVLDPEPDSDDDGDEEIRYLV
KLKSKRVRESHEGKESEGGTRMHSNGHDMEDTKHLSSDKLAVSGRKKPKVGMVDPLPAGATSGQIPTTRTRALQSGTDPH
SVIGSGPLEFPDGLPCPSSKKPKQKLSEVEQQSKKAEAAQRRRMQSEKAAQEAEAEAIRKILGQDSGRKKKEEKMKKQQE
ERAQERAARSSTLASNTIRLVIGPSGTTMTFSEDIGLPDIFKPITYSYPPPREKCVGPNCEKAYKYRDSKSKLPLCSLGC
YKAIQEKMEQALIHC*

DNA
ATGGAGGGATGTGAAGCTTCTGCTTCTTCTTTAGCTGGCTTTACCGGTAGGAGAAGGAGAAGCGCTCTGCCTCGTCGACC
CCGCCATATAAAAGGGAGCGCCCATAGTTTCAAGTTCTTGCCACCTTCAACACAGGCAAACACCAATAGTCTCTGTGGGT
CTGTGAGTGAGAACAAACTGAAACTGAAGCTTAAGCTTGGTGGTGGTGTTACACGTACGTTGCAAACCAACTCTGAGGCG
GGTCTTTATTCCAAAGCTTTGGATAATGGACAAAAGCCATTTCAAAATAAGGTAAAAGGCAATAGTCATGTTCAGAAAAC
ACTGTTTCTAGGAGATATCCATCAATCTAGAGGATATCCGTCTGTGACTGGGAACCGAATATCCATGTCTGAGAAGAGCA
AACGAGGTCTTAAGAAACGTGTATTGGATCCTGAACCAGACAGTGATGATGATGGAGATGAGGAAATCAGATACCTCGTA
AAGTTAAAGTCTAAAAGGGTCAGGGAGTCTCATGAAGGTAAAGAGAGTGAAGGAGGCACAAGGATGCACAGCAATGGTCA
TGACATGGAAGACACAAAACATCTCTCATCAGACAAACTTGCTGTATCCGGAAGGAAAAAGCCGAAGGTGGGAATGGTTG
ATCCGCTTCCGGCAGGAGCGACAAGCGGACAAATTCCTACTACGCGTACTCGGGCTCTCCAATCTGGAACGGATCCACAT
TCTGTCATTGGGTCGGGGCCTCTTGAATTCCCTGATGGCTTACCTTGCCCCTCATCTAAAAAACCAAAACAGAAGCTTTC
TGAGGTAGAGCAGCAATCCAAGAAGGCCGAAGCTGCACAGAGACGGCGAATGCAGTCTGAGAAGGCTGCCCAAGAAGCCG
AGGCTGAAGCTATCAGGAAAATACTTGGGCAAGATTCTGGGAGAAAGAAAAAAGAGGAGAAGATGAAAAAACAACAGGAA
GAACGAGCTCAGGAGAGAGCTGCAAGATCAAGCACACTCGCATCAAACACTATCAGATTGGTGATTGGTCCAAGTGGAAC
AACTATGACATTTTCTGAAGACATTGGTCTTCCGGATATCTTCAAGCCAATCACGTACAGTTATCCTCCTCCGCGAGAGA
AATGTGTGGGACCAAATTGCGAGAAAGCGTACAAGTACAGGGATTCAAAGTCGAAGCTGCCATTATGTAGTCTAGGGTGT
TACAAGGCCATTCAAGAGAAGATGGAACAAGCACTGATTCATTGCTAA