Details for Lyrate rockcress Locus 16040810

Position : sca3 ( 5`- 10050145 .. 10051092 -3` )
Annotation : [B2G] structural constituent of ribosome
External links : CoGe
PGDD synteny : 16040810

Protein [Map View]
MALMVLRRKCIRMPDITSVFRPARNCFSSRFSNSESGKDTVAGLSGCGIETVDDDAWHVSSSLSQAWRQFQADTAKNSPV
TIQGVRETMLDDEDPDHDEIDNMRIRGDLFYKLDRGSKEFEEYNYDFHRKNQHKNVKREQNQEEETTMKKNNKKEVREEY
KKRNDSFTGETDHPNAAVRKRERTFTFNQLTAPFHYPFCLDIYISKESVRACVIHRVTSKVVTVAHSISKDMKFDLGSTR
NAAACAAVGAVLAQRCLEDDIHDVIYTPRKGDKIEGKLQVVLQALIDNGVYVKVKLKQRKLKKKTSHLMMA*

DNA
ATGGCTTTGATGGTTTTAAGGAGAAAGTGTATCCGTATGCCGGATATCACCTCTGTTTTTCGACCTGCACGGAATTGTTT
CTCCTCGAGATTTTCCAACAGTGAAAGTGGAAAGGATACAGTGGCTGGTTTGAGTGGTTGTGGTATAGAAACTGTGGATG
ATGATGCTTGGCATGTCTCATCATCTTTATCTCAAGCTTGGAGACAGTTCCAAGCAGACACTGCAAAAAACTCTCCCGTT
ACAATACAAGGAGTAAGAGAAACAATGCTCGATGATGAAGATCCTGATCATGATGAAATCGATAATATGAGAATTCGCGG
TGATCTTTTCTACAAGCTTGATCGAGGTTCAAAAGAATTCGAGGAATACAACTACGACTTCCACCGCAAGAATCAACACA
AGAACGTTAAGAGAGAGCAAAACCAAGAAGAAGAAACAACGATGAAGAAGAATAATAAGAAGGAAGTTCGTGAGGAATAC
AAGAAGAGAAACGACTCATTTACCGGTGAAACAGATCATCCTAATGCAGCTGTGAGGAAGAGAGAAAGAACGTTTACGTT
TAACCAACTCACGGCGCCTTTTCACTACCCGTTTTGCTTAGACATATACATCTCGAAGGAGTCTGTTCGAGCATGTGTGA
TTCACAGGGTGACTAGTAAAGTTGTCACTGTAGCTCATTCCATTTCGAAAGACATGAAATTCGATCTTGGTTCCACTAGA
AACGCTGCAGCTTGCGCTGCGGTTGGGGCAGTCCTTGCTCAAAGATGTTTGGAGGATGATATACATGACGTTATATACAC
TCCTAGGAAAGGAGATAAAATCGAAGGTAAGCTTCAGGTTGTGCTTCAAGCTCTTATTGATAATGGTGTTTATGTTAAAG
TGAAGCTAAAGCAAAGGAAACTCAAGAAGAAGACTAGTCATCTAATGATGGCCTAG