Details for Lyrate rockcress Locus 16040753

Position : sca3 ( 5`- 8257469 .. 8262158 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040753

Protein [Map View]
MPLAYTFPVLPSSCLLCAISNRGTSFVVDRPELQISGLLVVRSESGEIFGSGLSLRRFQREGRRRLNAGGGGIHVVENAP
SRTSSLAASTSAIEIPVTCYQLIGVSDQAEKDEVVKSVINLKKADAEEGYTMEAAVARQDLLMDVRDKLLFEPEYAGNLK
EKIAPKSPLRIPWAWLPGALCLLQEVGQEKLVLDIGRAALRNLDSKPYIHDIFLSMALAECAIAKAAFEANKVSQGFEAL
ARAQCFLKSKVTLGKLALLTQIEESLEELAPPCTLDLLGLPRTPENAERRRGAIAALGELLRQGLSVEASCQIQDWPCFL
SQAISRLLATEIVDLLPWDDLAITRKNKKSLESHNQRVVIDFNCFYMVLLAHIAVGFSGKQNETINKAKTICECLIASEG
VDLKFEEAFCSFLLKQLSATGPTCWIAQGSEAEALEKLKQLESNSDSAVRNSILGKESRSTSAAPSLEVWLTESVLANFP
DTRGCSPSLANFFRGEKKYLENKKMGSPSIMNHKTNQRPLSTTQFVNSSQHLYTAVEQLTPTDLQSPVVSAKNNDESGAS
MPSVQLKRNLGVHKNKIWDEWLSQSSLIGRVSVVALLGCTVFFSLKLTGIRSGRLQRLPISVSGKPHSESDSFLWKTESG
SFRKNLASVNRNGIVGNIKVLLDMLKMDHGEHPDALYLKSSGQSATSLSHSASELHKRPMDTEDAEELVRQWENVKAEAL
GPTHQVYSLSEVLDESMLVQVTVSWQTLAQTAKAKSCYWRFVLLHLEILQAHIFQDGIAGETAEIEALLEEAAELVDESQ
PKNAKYYSTYKIRYTLKKQEDGSWKFCQSDIQIQK*

DNA
ATGCCGCTGGCTTACACATTTCCAGTTCTCCCTTCTTCTTGTCTGCTTTGCGCAATCTCTAATCGCGGCACCAGCTTCGT
CGTTGATCGCCCGGAGCTTCAGATCTCAGGTCTCCTCGTCGTTCGTTCTGAATCCGGTGAAATCTTCGGTTCTGGTTTAT
CTTTGCGGCGGTTTCAGCGTGAAGGACGGAGGAGGCTGAATGCTGGTGGTGGTGGTATCCATGTCGTGGAAAATGCGCCA
TCTCGTACTTCTTCCCTCGCTGCATCTACCTCGGCAATCGAAATCCCGGTTACGTGTTACCAGCTTATCGGAGTTTCTGA
TCAAGCTGAGAAAGACGAGGTGGTGAAGTCGGTTATAAATTTGAAAAAAGCTGATGCTGAAGAAGGTTATACAATGGAAG
CTGCTGTAGCTCGCCAGGATCTTCTCATGGATGTTAGGGATAAACTTCTTTTTGAACCAGAATATGCTGGTAACCTGAAA
GAAAAGATCGCTCCTAAATCTCCTCTTAGAATTCCGTGGGCATGGTTGCCTGGTGCTCTTTGCCTTCTTCAAGAGGTTGG
ACAAGAAAAACTCGTGCTGGATATTGGCCGGGCTGCTCTCAGGAACCTTGATTCGAAGCCATATATTCATGATATATTTT
TATCTATGGCACTTGCTGAGTGTGCGATTGCGAAGGCTGCTTTCGAGGCTAACAAGGTCTCTCAAGGATTTGAAGCTCTT
GCTCGTGCTCAATGTTTTCTGAAGAGTAAAGTTACTCTTGGGAAACTTGCATTGTTAACTCAGATTGAGGAGTCACTAGA
GGAGCTTGCACCTCCTTGCACATTGGATCTACTGGGCCTGCCTCGCACGCCGGAAAATGCAGAGAGGAGGCGAGGTGCAA
TTGCAGCGTTAGGCGAACTGCTCAGACAGGGCCTTAGTGTTGAAGCTTCATGTCAAATTCAAGACTGGCCATGCTTTTTG
AGCCAGGCGATCAGTAGGTTATTGGCCACAGAGATTGTCGATCTTCTTCCATGGGATGACTTAGCCATTACACGGAAAAA
TAAAAAATCACTCGAATCCCACAATCAAAGAGTGGTAATTGATTTTAATTGTTTCTACATGGTGTTACTTGCTCACATCG
CTGTTGGATTTTCAGGCAAGCAAAATGAAACGATTAATAAAGCAAAAACAATATGCGAATGTCTCATAGCATCAGAAGGT
GTTGATCTGAAATTTGAGGAAGCTTTTTGCTCATTTCTTCTAAAACAGTTAAGTGCTACTGGACCTACATGTTGGATAGC
ACAGGGTTCCGAGGCAGAGGCCCTGGAAAAACTTAAGCAGCTGGAATCAAATTCAGACTCTGCCGTTCGTAATTCGATCC
TGGGGAAAGAGTCGAGAAGTACTTCTGCTGCTCCATCACTGGAAGTGTGGCTTACGGAGTCCGTGCTTGCTAACTTTCCA
GACACAAGGGGTTGTTCTCCATCATTGGCCAATTTTTTTCGGGGTGAAAAGAAATATCTAGAAAACAAGAAAATGGGGTC
ACCTTCGATCATGAATCACAAGACAAACCAAAGACCGCTTTCCACAACGCAGTTCGTGAACTCGTCACAACATCTTTATA
CAGCTGTCGAGCAGTTGACACCAACAGATTTGCAGAGCCCAGTGGTATCCGCCAAGAATAATGATGAAAGCGGTGCCAGT
ATGCCATCTGTTCAACTGAAGAGGAACCTTGGTGTACACAAAAATAAAATATGGGATGAGTGGCTCTCTCAAAGCAGTTT
GATCGGAAGGGTATCTGTTGTTGCTTTACTGGGTTGCACCGTGTTCTTCTCTCTAAAGCTAACAGGCATTAGGTCTGGTA
GACTACAGAGGCTGCCTATATCGGTTTCTGGTAAGCCGCATTCGGAATCAGATTCTTTTCTGTGGAAAACCGAGTCTGGG
AGTTTCAGAAAAAACCTTGCTTCTGTGAATAGAAATGGTATCGTGGGCAACATCAAAGTGCTCTTGGACATGTTAAAGAT
GGATCATGGCGAACATCCAGATGCCTTGTATCTGAAAAGCTCTGGTCAATCAGCTACATCATTGTCTCATTCTGCGTCAG
AACTGCATAAAAGACCAATGGATACAGAAGACGCGGAAGAGCTTGTGAGACAGTGGGAAAATGTTAAGGCTGAAGCTCTT
GGACCAACACATCAAGTTTATAGCCTTTCCGAAGTCCTTGATGAATCCATGCTTGTCCAGGTTACTGTTTCTTGGCAAAC
GTTGGCACAAACAGCAAAAGCTAAATCCTGTTATTGGAGATTCGTTTTGCTTCATCTAGAGATTCTACAAGCACACATTT
TCCAAGATGGTATCGCTGGTGAGACTGCAGAAATCGAAGCCCTTCTAGAGGAAGCAGCAGAATTAGTTGATGAATCTCAG
CCCAAAAACGCAAAATATTACAGCACTTACAAGATCCGCTATACGCTGAAGAAGCAAGAAGATGGATCGTGGAAATTCTG
CCAAAGCGATATTCAAATACAGAAGTGA