Details for Lyrate rockcress Locus 16040737

Position : sca3 ( 5`- 5811875 .. 5811498 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040737

Protein [Map View]
MDPHLVITATSSAFRWPSSHRKIYLRRRKPQVVRLGGKNSTPRGRFSLKKVVTRMRLKWLRLYYVRLVKKIKAYYRTIVK
EFEDAGAATIQQRMTVETAAFAAPGLGLSFCPMSGYVDQPRFFLV*

DNA
ATGGATCCCCATTTGGTCATCACTGCCACCTCCAGCGCATTCCGGTGGCCGTCAAGTCACCGGAAGATCTATCTCCGTCG
GCGTAAGCCACAAGTTGTGCGTCTCGGCGGGAAAAACAGTACGCCACGTGGCAGGTTCTCGCTTAAGAAGGTGGTAACGA
GGATGAGACTCAAGTGGCTGAGACTGTACTACGTGAGGCTCGTGAAGAAAATCAAAGCGTATTATCGTACTATAGTGAAG
GAGTTCGAGGACGCCGGAGCCGCCACCATCCAGCAGCGCATGACGGTGGAAACGGCTGCTTTTGCCGCTCCTGGCTTAGG
CTTATCTTTCTGTCCCATGTCCGGCTACGTCGACCAGCCTCGTTTTTTTCTTGTATAG