Details for Lyrate rockcress Locus 16040729

Position : sca3 ( 5`- 9465948 .. 9466265 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040729

Protein [Map View]
MKTVSARSNIPLYVFVLALVLSPKLLCQADGMPLGVFLRQKVMFLWKGGVRKLMAPSPPILMCPQCECCAPAPPGFCCPC
RCPDGP*

DNA
ATGAAAACAGTGTCAGCAAGATCCAACATCCCCCTATATGTTTTTGTTCTCGCGCTAGTCTTGTCTCCAAAACTTCTATG
TCAAGCAGATGGTATGCCTCTAGGAGTTTTTCTTAGACAAAAAGTGATGTTTTTATGGAAAGGTGGAGTGCGTAAGCTCA
TGGCACCGTCACCACCTATTCTCATGTGTCCACAGTGTGAATGTTGTGCACCGGCTCCACCTGGTTTTTGTTGCCCATGT
CGTTGTCCTGACGGTCCCTGA