Details for Lyrate rockcress Locus 16040712

Position : sca3 ( 5`- 1018369 .. 1018151 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040712

Protein [Map View]
MIPICVQCGTGGNPCRCKVVGPTLGLVAFVAAGIVEWPVGALVYIFKHAKGRRIMGHPATHVYPKVSRSIPI*

DNA
ATGATTCCGATATGCGTGCAATGCGGAACAGGCGGAAACCCTTGTAGATGCAAAGTGGTAGGACCGACGTTAGGGCTTGT
GGCGTTTGTAGCAGCCGGAATAGTGGAATGGCCGGTCGGAGCTTTGGTTTATATCTTTAAACACGCAAAGGGTCGACGCA
TTATGGGTCATCCGGCCACCCATGTTTATCCCAAAGTCTCTCGTTCCATTCCCATATGA