Details for Lyrate rockcress Locus 16040696

Position : sca3 ( 5`- 4712441 .. 4711858 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040696

Protein [Map View]
MSQPNLLRYVIEQATRGGKSVVSRRNFSSSHCKFDERERSVLMYKMKSSTNRRRLLAFLVATSLSFHLWEFTKKQNARHE
AKKVQLDPKN*

DNA
ATGTCGCAGCCGAATCTTCTGAGATACGTCATCGAGCAGGCAACTCGCGGAGGGAAATCTGTTGTGTCTCGACGCAATTT
CTCTTCTTCGCATTGTAAATTTGATGAGAGAGAAAGGTCTGTTCTCATGTATAAGATGAAATCGTCGACAAATAGACGTC
GTTTATTGGCTTTTTTAGTGGCTACCTCTCTGAGCTTCCATCTTTGGGAATTTACCAAGAAGCAAAATGCTCGGCATGAG
GCCAAGAAGGTGCAGCTGGATCCGAAGAATTAA