Details for Lyrate rockcress Locus 16040675

Position : sca3 ( 5`- 711667 .. 713513 -3` )
Annotation : [B2G] integral membrane family protein
External links : CoGe
PGDD synteny : 16040675

Protein [Map View]
MEWPWSAIAAASSSSSSCFFASPNSCLSITRRANSSCANKYPSNILVKSLRHSRFDSKHILVSIFKRRINGDSVVRRSTT
SNKSTEETESSSSSSVDCVGMGSDVECVYNGEDEENRSSGILNGGEGTLLEWTVLISPFFFWGTAMVAMKEVLPITGPFF
VAAFRLIPAGLLLVAFAVYKARPLPKGINAWLSIALFALVDATCFQGFLAQGLQRTSAGLGSVIIDSQPLTVAVLASFLF
GESIGIVRAGGLLLGVAGLLLLEVPSVTSDGNNFSLWGSGEWWMLLAAQSMAIGTVMVRWVSKYSDPIMATGWHMVIGGL
PLLAISVINHDPVFNGSLQELSTNDVIALLYTSIFGSAVSYGVYFYSATKGSLTKLSSLTFLTPMFASIFGYLYLNETFS
SLQLVGAAVTLVAIYLVNFPEGND*

DNA
ATGGAATGGCCATGGTCGGCCATCGCTGCTGCTTCTTCCTCTTCTTCTAGTTGCTTCTTTGCTTCTCCTAACTCTTGCTT
GTCTATTACTAGACGAGCGAATTCGAGCTGTGCTAACAAATATCCATCGAACATTTTGGTTAAATCCTTGCGACATAGCA
GATTCGACTCGAAGCATATTCTCGTTTCGATCTTTAAACGTCGAATCAATGGAGATTCCGTTGTTCGGAGAAGCACCACT
AGCAATAAAAGCACCGAGGAGACTGAATCATCATCGTCTTCGTCAGTAGATTGCGTTGGAATGGGATCAGACGTGGAATG
CGTCTACAACGGAGAAGATGAGGAGAATCGGAGCTCCGGAATCTTGAACGGCGGAGAAGGAACGTTGCTTGAATGGACGG
TTCTGATTTCACCCTTCTTTTTCTGGGGAACGGCGATGGTGGCGATGAAGGAAGTGTTGCCCATTACTGGTCCTTTCTTC
GTGGCCGCGTTTCGGTTAATTCCGGCTGGTTTGTTGCTTGTCGCGTTTGCAGTTTACAAAGCCAGACCTTTGCCTAAAGG
AATCAATGCTTGGCTCTCTATTGCTCTCTTTGCTCTTGTGGACGCCACTTGTTTCCAGGGATTTCTTGCTCAAGGGTTAC
AGAGAACTTCTGCTGGTTTAGGAAGTGTTATAATTGATTCTCAGCCACTGACTGTTGCTGTATTAGCATCTTTCTTGTTT
GGTGAGTCCATTGGAATAGTGAGAGCTGGAGGTTTGCTTCTTGGTGTTGCTGGACTTTTGCTTCTTGAGGTTCCATCAGT
TACTTCAGATGGTAATAACTTTTCCTTGTGGGGAAGTGGAGAGTGGTGGATGCTTCTTGCAGCTCAGAGCATGGCTATTG
GCACTGTGATGGTCCGATGGGTCTCAAAATACTCAGATCCAATTATGGCTACCGGTTGGCATATGGTAATCGGTGGCCTT
CCTCTTTTGGCGATTTCTGTTATAAACCATGACCCGGTTTTTAATGGCAGTCTTCAAGAGCTATCCACAAATGATGTTAT
AGCACTTCTCTACACATCCATTTTTGGCAGCGCAGTTAGCTATGGTGTTTACTTCTACAGCGCTACTAAAGGAAGCCTAA
CTAAACTCAGCTCACTCACCTTCCTGACACCAATGTTTGCATCAATCTTTGGATATTTGTACCTCAATGAGACTTTCTCC
TCATTGCAACTGGTGGGAGCAGCAGTCACTTTGGTCGCTATATACTTGGTAAACTTTCCCGAAGGCAACGACTGA