Details for Lyrate rockcress Locus 16040583

Position : sca3 ( 5`- 565668 .. 569058 -3` )
Annotation : [B2G] rna binding protein
External links : CoGe
PGDD synteny : 16040583

Protein [Map View]
METDLNDYTVIKEGEAEILMHKKNQVFFNKAQVNNRDMSIAVLREFISKRKQEHEAKSSKRTRPASKVIEKDASEASKEE
TPSKNGMNNGDHEVASEDGPSSASKDPAKTTERFAPREPKPPKVLEALSASGLRALRYAREIEGIGQVVALDNDLASVEA
CQRNIKFNGSVAISKVESHHTDARVHMLTHPKEFDVVDLDPYGSPSIFLDSAIQSVTDGGLLMCTATDMAVLCGGNGEVC
YSKYGSYPLRAKYCHEMALRILLASIESHANRYKRYIVPVLSVQMDFYVRVFVRVYTSASAMKNTPLKLSYVYQCIGCDS
FHLQPVGRSLPKNNSVRYLPAIGPLVKQDCNHCGKKYNMGGPIWSAPMHDQEWVTSILNSVKSMKDRYPAYDLISAVLTT
VSEELLDVPLFLSLHNLCATLKCISPSAAMFRSAVINANYRISGTHVNPLGMKTDAPMEVIWDIMRCWVKNHPIKAQSPE
QPGSVILSKEPSHEVDFSRHIGSLSKAQAKKVARFLPNPEKHWGPKLRAGRQITSKHVSLIGHEAVNGHLNQHPEELKED
EEAEQEDNVQVEVDPKRQKTTTENMSSTS*

DNA
ATGGAAACGGATCTGAATGACTATACTGTTATCAAGGAAGGAGAAGCTGAGATTCTCATGCACAAGAAGAATCAAGTCTT
CTTCAATAAAGCTCAGGTGAACAATAGAGACATGTCCATTGCTGTTCTAAGGGAATTTATATCAAAACGCAAGCAAGAGC
ATGAAGCTAAGTCATCTAAAAGAACTAGACCAGCTTCCAAAGTGATCGAGAAGGATGCTTCTGAAGCTTCCAAGGAAGAA
ACTCCGAGCAAGAACGGTATGAATAATGGTGATCACGAAGTAGCATCTGAAGATGGACCAAGCTCTGCATCAAAAGACCC
TGCTAAGACAACAGAACGATTTGCACCTAGAGAACCCAAGCCACCAAAAGTTCTTGAGGCTTTGTCAGCTTCTGGGTTAC
GGGCTCTAAGATATGCACGTGAAATAGAAGGAATTGGTCAGGTTGTGGCGTTGGATAATGATTTAGCATCGGTCGAAGCT
TGCCAGAGAAACATAAAGTTCAATGGCTCAGTGGCTATTTCAAAGGTGGAGTCACATCATACCGATGCTCGTGTCCATAT
GCTTACCCACCCTAAAGAATTTGATGTGGTTGATCTTGATCCATATGGATCACCGTCTATTTTCCTTGACTCGGCTATTC
AATCAGTCACGGATGGTGGATTGCTAATGTGTACAGCAACTGACATGGCAGTGTTATGTGGTGGTAACGGTGAAGTTTGC
TATTCCAAATATGGTTCTTACCCATTGAGAGCGAAGTATTGTCATGAGATGGCTTTGCGGATCCTTCTTGCCAGCATCGA
GAGCCATGCAAACCGCTACAAGCGGTATATTGTTCCGGTGCTATCTGTGCAAATGGATTTCTATGTTCGTGTTTTTGTCC
GCGTTTACACCTCGGCGAGTGCAATGAAGAACACTCCATTGAAACTCTCTTACGTATATCAATGCATTGGCTGTGATTCA
TTTCATCTTCAACCTGTTGGAAGATCTCTCCCTAAGAACAACAGTGTGAGGTATCTACCAGCAATTGGTCCGCTTGTGAA
GCAGGATTGCAACCACTGTGGGAAGAAATATAACATGGGTGGACCAATATGGTCTGCTCCAATGCATGATCAAGAATGGG
TGACTTCGATATTAAACAGTGTAAAATCCATGAAAGACAGATATCCTGCTTATGACCTGATCTCTGCTGTACTTACTACA
GTCTCCGAGGAATTGCTGGATGTTCCTCTGTTTTTGAGTCTGCATAATCTTTGTGCGACACTAAAGTGCATTTCACCATC
AGCTGCAATGTTTCGATCAGCGGTTATTAATGCTAATTACCGTATCTCGGGGACTCATGTGAATCCGCTTGGCATGAAAA
CTGATGCTCCTATGGAGGTTATCTGGGACATTATGCGCTGCTGGGTGAAGAATCATCCCATAAAGGCGCAATCGCCTGAG
CAACCCGGTAGTGTGATCTTGTCCAAAGAACCATCACATGAGGTTGATTTTTCGCGTCACATTGGTTCGCTGAGCAAGGC
ACAGGCAAAGAAAGTAGCTCGTTTTCTGCCAAATCCAGAGAAGCATTGGGGTCCAAAGCTTAGGGCTGGTCGCCAGATTA
CGAGCAAACATGTATCTCTTATTGGTCATGAAGCAGTCAATGGTCATCTTAACCAACACCCTGAAGAACTTAAAGAAGAT
GAAGAAGCAGAGCAAGAAGATAATGTCCAAGTAGAGGTTGATCCGAAACGCCAGAAGACAACAACAGAGAATATGTCATC
AACATCATAA