Details for Lyrate rockcress Locus 16040574

Position : sca3 ( 5`- 4838054 .. 4825885 -3` )
Annotation : [B2G] s1 rna-binding domain-containing protein
External links : CoGe
PGDD synteny : 16040574

Protein [Map View]
MVVPQKKFANGKRHDSTKSFKPTKKPFKKTKDDVAARSEAMALQLDDVLDFPRGGGTSLSKKEREKIYEEVDAEFDADER
VSKKSKGGKSKKRIPSDVDDLGLLFGGLNGKRPRYANKITTKNISPGMKLLGVVIEVNQKDIVISLPGGLRGLVRASEAS
DFTDLGIEVFSANVKSVEDHGYILHFGLPSISGFIEISNDGNQESVMKTGQLIQGVVTKIDRDRKVVHLSSDPDSVAKCL
TKDLNGMSFDLLIPGMMVNARVQSVLENGILFDFLTYFNGTVDLFHLKNPLSNKSWKDEYNQNKMVNARILFIDPSSRAV
GLTLNPHLVCNKAPPLHVFSGDIFDEAKVVRIDKSGLLLELPSKPVPNPAYISFKEGNHIRVRILGLKQMEGLAIGTLKE
SAFEGPVFTHSDVRPGMVTKAKVISVDTFGAIVQFAGGLKAMCPLRHMSEFEVMKPRKKFKVGAELVFRVLGCKSKRITV
TYKKTLVKSKLPILSSYTDATEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGLEPGSDPDSVFHVGEVVKCRVTSA
VHGSRRITLNDSIKLGSIVSGIVDSITSQAVIVRVKSKGVLKGTISTEHLADHHDQAKLMMSLLRPGYELDKLLVLDIEG
NNLSLSSKYSLIKLAEELPSDFNQLQPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDDPRADLSESFFVGQSVRA
NIVDVNQEKSRITLSLKQSSCASVDASFVQEYFLMDEKISDLQSSDITKSEYSWVEKFSIGSLIKGTLQEQNDLGVVVNF
DNINNVLGFIPQHHMGGATMVPGSVVNAVVLDISRAERLVDLSLRPELINNLTKEVSNSQLKKKRKRGISKELEVHQRVS
AVVEIVKEQHLVLSIPEHGYTVGYASLSDYNTQKLPVKQFSTGQSVVASVEAVQNPLTSGRLLLLLDSVSGTSETSRSKR
AKKKSSCEVGSVVHAEITEIKPFELRVNFGNSFRGRIHITEVNDASTSDEPFAKFRVGQSMSARVVSKPCHTDIKKSQLW
ELSVKPAMLRDSSELNDIQESEQLEFVAGQCVNGYVYKVDKEWVWLAISRNVTARIFILDTACEAHELEEFERHFPIGKA
VSGYVLTYNKEKRTLRLVQRPLLDIHKSIANGGGSKTDKLDISIPGDDGTLFIHEGDILGGRISKILPGVGGLRVQIGPY
VFGRVHFTEINDLWVPNPLDGFREGQFVKCKVLEISSSSKGTWQIELSLRTSLDGMSSADHISEDLNNNDNVCKRFERFE
DLSLDMGVQGYVKNTMSKGCFIILSRKVEAKVKLSNLCDTFVKEPEKEFPVGKLVTGRVLNVEPLSKRIEVTLKTVNAGG
QPKSESYDMKKLHVGDMISGRIKRVEPYGLFIDIDQIGMVGLCHITQLSDDRIENVQARYKAGESVSAKILKLDEEKRRI
SLGMKSSYLMNGDDVKAQPPSEEKADETSMECDPINDPNTEVLAAVGDFGFQETSGGRHSGASLVLAQVDSRASIPPLEV
DLDDIEEMDFDNNQNQEKLLGADKDEKSKRREKQKDKEEREKKIQAAEGRLLEHHAPESADEFEKLVRSSPNSSFVWIKY
MAFMLSLADIEKARSIAERALRTINIREEEEKLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDPKKVYLALLGVYER
TEQYKLVDKLLDEMVKKFKQSCKIWLRKIQSSLQQNEEGIQSVVNRALLCLPRHKHIKFISQTAILEFKCGVADRGRSLF
EGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFERAISLSLPPKKMKFLFKKFLEYERSVGEEERAEYVKQRALEYAKS
TLA*

DNA
ATGGTAGTACCGCAGAAGAAATTTGCTAATGGAAAACGTCATGATTCTACAAAGTCCTTTAAACCAACGAAGAAACCGTT
TAAGAAGACCAAGGACGATGTAGCTGCTAGGTCTGAAGCCATGGCTCTTCAGCTCGACGATGTTCTTGACTTTCCTCGAG
GTGGAGGGACTTCTCTGAGTAAAAAAGAGCGTGAGAAAATTTATGAAGAAGTCGATGCTGAGTTTGACGCTGATGAGCGT
GTTTCTAAGAAGAGTAAAGGAGGAAAGTCTAAAAAGAGAATCCCTAGCGATGTAGACGATTTGGGATTGCTTTTTGGCGG
CCTTAATGGAAAACGGCCTAGATATGCCAATAAGATTACCACTAAGAATATCTCCCCAGGAATGAAGCTTTTGGGAGTTG
TTATTGAAGTAAACCAGAAGGATATTGTAATTAGTCTTCCCGGGGGCTTACGTGGATTAGTTCGCGCAAGCGAGGCATCA
GATTTTACAGATCTTGGGATTGAGGTGTTCTCTGCTAACGTGAAAAGCGTTGAAGACCATGGTTATATCCTTCATTTTGG
ATTACCTTCTATCTCAGGATTCATCGAAATAAGCAACGATGGAAACCAGGAGTCAGTAATGAAGACTGGGCAGCTTATTC
AGGGCGTGGTTACAAAGATAGATAGAGATCGTAAAGTTGTTCATCTTAGTTCTGACCCAGATTCAGTGGCAAAGTGTCTG
ACCAAGGATCTTAATGGCATGTCGTTTGATCTTCTCATCCCAGGCATGATGGTTAATGCTCGCGTGCAATCAGTCCTTGA
GAATGGGATACTGTTTGATTTTCTTACATACTTTAATGGAACAGTTGATCTCTTCCACCTAAAAAATCCATTGTCTAACA
AAAGCTGGAAGGATGAGTATAATCAGAATAAGATGGTTAATGCTAGAATATTGTTTATCGATCCATCATCTAGAGCTGTT
GGTTTGACATTGAACCCTCATCTTGTTTGTAACAAGGCTCCTCCGTTGCATGTCTTTAGTGGAGACATATTCGATGAAGC
AAAAGTAGTTCGTATTGATAAATCAGGCCTTCTTCTGGAACTTCCTTCTAAGCCCGTACCAAATCCAGCATACATCAGCT
TTAAGGAAGGAAATCACATCCGTGTTCGAATACTTGGCCTTAAGCAGATGGAAGGGTTGGCCATAGGGACTTTAAAGGAA
AGTGCCTTTGAAGGTCCAGTTTTCACCCACTCTGATGTCAGACCTGGTATGGTGACAAAGGCAAAAGTCATATCTGTTGA
TACGTTTGGTGCCATTGTGCAATTTGCGGGTGGTCTCAAAGCGATGTGCCCACTTCGGCATATGTCTGAGTTTGAAGTTA
TGAAGCCCAGGAAAAAGTTCAAGGTTGGAGCTGAATTAGTATTCCGTGTGCTTGGCTGCAAATCAAAGAGAATAACTGTT
ACCTACAAGAAAACACTTGTGAAGTCTAAACTTCCAATTTTGAGTTCTTACACTGATGCAACTGAAGGGCTAGTGACGCA
TGGCTGGATAACAAAGATTGAAAAGCATGGATGCTTTGTTCGCTTCTATAATGGAGTGCAAGGATTTGTTCCCAGATTTG
AACTTGGTTTAGAGCCTGGAAGTGATCCAGATTCAGTGTTTCATGTTGGGGAGGTTGTCAAATGTAGAGTAACCAGTGCG
GTTCATGGTTCTCGAAGGATCACCCTTAACGATTCAATCAAGTTAGGTAGCATTGTATCAGGAATAGTTGATAGTATAAC
TAGTCAGGCAGTCATTGTCCGTGTTAAATCCAAAGGTGTTCTCAAGGGTACAATTTCTACTGAACATTTAGCTGATCATC
ATGATCAAGCAAAATTAATGATGTCACTTTTAAGACCTGGATATGAGCTTGATAAGCTGCTGGTACTAGACATTGAAGGC
AACAACTTGTCTCTCTCTTCAAAATATTCTCTCATTAAGTTAGCTGAAGAGCTTCCTTCGGATTTTAATCAGCTCCAGCC
AAACTCAGTGGTTCATGGTTATGTTTGTAACTTGATTGAAAATGGCTGCTTTGTCCGTTTTCTTGGTCGGTTGACTGGTT
TCGCCCCAAGAAGCAAGGCAATTGACGACCCCAGGGCAGATCTGTCAGAATCCTTCTTTGTTGGACAATCTGTTCGGGCT
AATATAGTTGATGTCAATCAAGAAAAAAGTAGGATAACTCTTTCATTGAAACAGTCTTCTTGCGCATCTGTAGATGCTTC
TTTTGTCCAAGAGTACTTCCTCATGGATGAGAAGATATCGGACCTGCAATCATCTGATATTACTAAAAGTGAATATAGCT
GGGTTGAGAAATTCTCAATTGGGAGTTTGATCAAGGGAACCCTACAGGAACAAAATGATCTGGGTGTGGTGGTGAATTTT
GACAATATTAACAACGTCCTTGGTTTTATACCTCAGCATCATATGGGTGGAGCTACTATGGTACCCGGTTCTGTTGTCAA
TGCAGTTGTTCTTGATATTTCAAGGGCAGAGAGACTAGTTGATTTGTCTTTGAGGCCTGAGCTCATAAACAACTTAACTA
AAGAGGTGTCCAACAGTCAGTTGAAAAAGAAACGTAAAAGAGGAATCTCCAAGGAACTTGAAGTCCACCAGAGGGTCAGT
GCTGTTGTAGAGATTGTGAAGGAGCAACACTTGGTTTTGTCGATTCCAGAGCATGGTTACACTGTAGGATATGCATCATT
ATCAGACTATAACACACAGAAGTTGCCAGTGAAACAATTTTCCACTGGACAAAGTGTTGTTGCTTCTGTTGAGGCTGTGC
AAAACCCTTTAACGTCTGGGAGGTTGCTTTTACTTCTTGACTCTGTTTCCGGCACTTCTGAGACTTCCCGTTCTAAGAGG
GCAAAGAAGAAATCCAGCTGTGAAGTTGGTTCTGTCGTCCACGCCGAGATTACTGAAATAAAGCCTTTTGAACTTAGAGT
AAACTTTGGCAACAGTTTCCGGGGAAGAATCCACATAACTGAGGTAAATGATGCAAGTACAAGTGATGAACCTTTTGCGA
AATTCAGAGTCGGGCAATCAATGTCTGCAAGGGTTGTTTCAAAGCCGTGTCATACTGATATTAAAAAGAGTCAACTTTGG
GAGCTTTCTGTAAAGCCTGCAATGCTTAGAGATTCCAGTGAGTTGAATGACATACAAGAGAGTGAACAACTTGAGTTTGT
TGCTGGACAATGTGTCAATGGATATGTCTACAAAGTGGACAAGGAATGGGTTTGGTTAGCAATATCTCGCAACGTGACGG
CACGCATATTCATTTTAGACACTGCATGCGAAGCTCATGAACTTGAGGAGTTCGAAAGGCATTTTCCCATCGGTAAAGCT
GTTTCAGGCTATGTTTTGACTTACAATAAAGAGAAAAGAACATTACGGTTGGTTCAGCGTCCACTTCTTGATATCCACAA
AAGCATTGCCAATGGTGGAGGCAGCAAAACAGATAAACTAGACATTAGCATTCCTGGTGATGATGGTACTCTATTTATTC
ATGAAGGAGACATTCTGGGTGGAAGAATTTCTAAGATACTTCCTGGTGTTGGTGGACTTCGTGTGCAAATAGGTCCTTAT
GTATTCGGGAGAGTTCATTTTACTGAAATCAATGATTTATGGGTACCCAATCCATTAGATGGTTTTCGTGAGGGCCAGTT
TGTCAAATGCAAGGTCTTAGAAATCAGCAGTTCTAGTAAAGGGACTTGGCAAATTGAACTGTCATTACGGACATCACTAG
ATGGCATGAGTTCTGCTGACCATATCTCAGAAGATTTGAATAATAATGACAATGTTTGTAAGCGTTTTGAGAGGTTTGAA
GATCTTTCTCTTGATATGGGCGTCCAGGGTTATGTCAAAAATACGATGTCGAAAGGTTGTTTTATTATACTTTCAAGGAA
AGTAGAGGCAAAAGTTAAACTGTCAAATTTATGTGATACTTTTGTTAAGGAACCCGAAAAGGAATTTCCAGTAGGAAAAC
TTGTAACTGGCAGGGTTTTAAATGTGGAGCCTTTATCCAAGCGGATAGAAGTCACTTTGAAGACAGTAAATGCTGGTGGG
CAGCCAAAATCTGAATCTTATGACATGAAGAAACTCCATGTTGGTGATATGATTTCTGGGAGAATCAAACGTGTGGAGCC
CTATGGCTTATTCATTGACATTGATCAAATTGGCATGGTTGGATTATGTCACATAACACAGCTTTCTGATGATCGTATCG
AGAATGTACAAGCCAGGTATAAGGCTGGGGAGAGCGTGAGCGCAAAGATTTTGAAGCTGGACGAGGAAAAGCGACGTATA
TCGCTCGGAATGAAAAGTTCTTATCTTATGAATGGTGATGATGTCAAGGCACAACCACCTTCCGAAGAAAAAGCTGATGA
AACAAGCATGGAATGTGATCCAATCAATGATCCGAATACAGAAGTTCTTGCAGCAGTCGGTGATTTTGGGTTCCAGGAAA
CAAGCGGTGGAAGACATAGTGGAGCTTCTCTGGTTCTTGCCCAAGTAGATTCAAGGGCTTCTATTCCTCCACTTGAGGTT
GACCTTGATGACATTGAGGAGATGGACTTTGACAACAACCAAAATCAGGAAAAACTACTGGGAGCCGATAAAGATGAAAA
GAGCAAGAGAAGGGAAAAGCAAAAAGACAAGGAGGAAAGAGAGAAAAAAATACAAGCTGCTGAAGGAAGATTGCTGGAGC
ATCATGCACCTGAGAGTGCTGATGAGTTTGAGAAATTGGTTAGAAGCTCTCCAAACAGCAGCTTTGTCTGGATAAAATAT
ATGGCGTTCATGCTCAGCCTGGCTGATATTGAGAAAGCCAGGTCTATTGCTGAGAGGGCCTTGAGGACTATAAATATACG
TGAGGAAGAAGAGAAGCTAAACATATGGGTTGCTTACTTCAATTTGGAAAATGAACATGGAAGTCCACCGGAGGAAGCCG
TTAAGAAAGTGTTTGAAAGGGCCCGTCAATACTGTGACCCAAAGAAAGTTTACCTCGCACTCTTGGGCGTGTACGAGAGA
ACAGAGCAATATAAATTGGTTGATAAGCTGCTTGATGAGATGGTTAAGAAGTTCAAGCAATCTTGCAAGATTTGGTTAAG
GAAAATACAAAGTTCTCTACAACAAAACGAGGAAGGCATTCAATCCGTTGTGAACCGCGCCTTGCTATGTCTTCCGCGCC
ATAAGCACATTAAGTTCATATCACAAACTGCTATCCTTGAGTTCAAATGTGGAGTTGCGGATAGAGGGAGATCATTGTTT
GAAGGCGTTCTTAGGGAATACCCGAAAAGAACAGACTTGTGGAGTGTTTATCTTGACCAAGAGATCCGGCTGGGAGAAGT
GGATGTAATTAGATCTTTATTCGAGAGAGCCATTAGCTTGAGCTTGCCTCCCAAGAAGATGAAGTTCTTGTTCAAGAAGT
TCTTGGAATATGAGAGATCTGTTGGTGAAGAGGAGAGAGCCGAATACGTGAAACAGAGGGCGTTGGAGTACGCAAAAAGT
ACTTTGGCCTGA