Details for Lyrate rockcress Locus 16040556

Position : sca3 ( 5`- 10732127 .. 10732920 -3` )
Annotation : [B2G] ribosomal protein
External links : CoGe
PGDD synteny : 16040556

Protein [Map View]
MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLQCQSCKHF
SQRPIKRCKHFEIGGDKKGKGTSLF*

DNA
ATGGTGAACATTCCAAAGACAAAGAACACTTACTGTAAGAACAAGGAATGCAAGAAACATACTTTGCACAAGGTTACCCA
GTACAAGAAGGGTAAAGACAGTCTTGCTGCTCAAGGAAAGCGTCGTTATGACCGTAAACAATCTGGTTATGGTGGTCAGA
CTAAGCCCGTCTTCCACAAGAAGGCTAAGACCACGAAGAAGATTGTTCTGAGGCTTCAGTGCCAAAGCTGCAAGCACTTT
TCGCAGCGCCCGATCAAGAGGTGCAAGCATTTTGAGATTGGTGGAGACAAGAAGGGAAAGGGAACATCTCTCTTCTAA