Details for Lyrate rockcress Locus 16040529

Position : sca3 ( 5`- 7137937 .. 7133874 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16040529

Protein [Map View]
MSSKSTKRKVTETFDSLKSKKPKLVSGEQQQQQHGKPKFVKPKSFGDSLSKKERRVQAKELTEARKKKRKPHYNLEQELA
SLWEKMRRRDIGKEDRSKLISEAIRKMKGKVPEIAVSHVSSRVLQTCVKFCSQAEKDALFAELQPQFLNLASNKYAVHFI
QKMLDGASKQQLAACIFSLRGHVAPLLRHLFGSVVVEHAYRLGTAAQKQELLAELYSTELQLFKGLTSSTEKTVVDIIAK
LGLQKGAVNRHMTAIIQPILEKGIVDHTITHKLLIEYLTIADKTSAADVLQLLTGSLLLRMVHTRDGSRLAMLSIKHGSA
KERKKIIKAMKEHVTKMGFYQFGSMVLACIFSIVDDTKLVTKIIVRELEASLKDLVMDKNGRRPLLQLLHPNSSRYLSHD
DLAALDLSVPSLCSMDKSDTSSKTKDTDGNESGEETKDEQDDTVAEHTDHEENVTAMGGKKDPLVRRQELLVNSGLAERL
IDVCVENAEEFLKSNFGKEVMYEVAIGGSDGILCPSLSEKLYELYEAISSVAAKPKPQESGKDSEHILENFHSSRTIRRL
VLDCPGFASTLFKKALSGKCRSWAQGHCSKILSAFLETEDFQVREMAKTELQVLVSEGTLKISAAKKPE*

DNA
ATGTCTTCCAAATCGACCAAGAGGAAGGTTACTGAAACATTCGATTCTCTAAAATCGAAGAAGCCAAAGCTGGTGTCTGG
AGAACAACAACAACAACAACATGGGAAACCTAAATTTGTTAAACCCAAATCTTTTGGAGACAGTCTATCGAAGAAGGAGC
GTCGTGTACAGGCTAAGGAGCTAACAGAAGCTAGGAAGAAGAAGAGGAAGCCACATTACAATCTTGAGCAAGAGCTTGCA
TCTCTATGGGAGAAGATGAGGCGTCGTGATATTGGCAAGGAGGACCGATCAAAGCTGATTTCTGAAGCTATAAGGAAGAT
GAAGGGGAAGGTTCCAGAGATTGCAGTCTCACATGTTTCATCCCGTGTACTCCAGACTTGTGTGAAGTTTTGCTCACAAG
CTGAAAAAGATGCTCTCTTCGCCGAACTCCAGCCACAGTTTCTTAACCTTGCTTCTAATAAATATGCTGTTCATTTTATA
CAGAAGATGTTGGATGGAGCATCTAAGCAGCAGCTGGCAGCTTGTATATTCAGCCTCCGGGGACATGTTGCTCCTCTTCT
CCGTCACCTGTTTGGATCTGTTGTTGTGGAGCATGCATACCGTCTGGGAACTGCTGCACAAAAACAAGAACTCCTTGCAG
AATTGTATTCTACAGAGCTTCAGTTATTCAAGGGCTTGACCTCATCTACCGAAAAAACGGTGGTAGACATCATCGCTAAG
CTAGGACTGCAAAAAGGTGCTGTTAACCGACACATGACTGCCATTATCCAACCGATTCTTGAGAAGGGAATTGTCGACCA
CACTATCACACACAAATTGCTGATTGAATACCTGACAATAGCTGATAAGACTTCTGCTGCAGATGTGCTTCAGCTACTGA
CAGGCTCCCTTCTTTTGCGTATGGTTCATACCCGTGATGGTTCTAGGCTTGCCATGCTTTCTATCAAACATGGAAGCGCC
AAGGAGAGAAAGAAGATTATCAAAGCAATGAAAGAGCATGTTACAAAGATGGGTTTTTATCAGTTTGGAAGTATGGTGCT
TGCATGTATTTTTTCAATAGTTGATGACACAAAGCTCGTGACCAAGATAATTGTTCGTGAGCTCGAGGCCAGCCTAAAGG
ATCTTGTTATGGACAAGAATGGTAGGAGACCGCTATTGCAGCTACTGCATCCAAATTCTTCACGTTATTTGAGCCATGAT
GATTTGGCCGCTCTTGATCTTTCTGTTCCATCACTCTGCTCAATGGATAAGTCAGACACATCCTCTAAAACAAAGGACAC
AGATGGTAACGAATCTGGTGAGGAGACGAAGGATGAACAAGACGATACAGTAGCTGAACATACAGATCATGAAGAAAACG
TCACAGCTATGGGCGGTAAAAAAGATCCCCTTGTGAGAAGACAGGAGTTGCTCGTCAACAGTGGCCTTGCTGAGAGGCTT
ATTGATGTGTGCGTGGAAAATGCCGAGGAATTCCTCAAGTCCAACTTTGGCAAAGAGGTCATGTATGAGGTTGCCATCGG
AGGCTCCGATGGTATTCTTTGCCCATCTCTGAGCGAGAAGCTGTATGAGCTGTACGAAGCTATTAGCTCTGTAGCAGCAA
AACCGAAACCCCAAGAATCTGGGAAGGATTCAGAGCACATCCTGGAAAACTTTCACTCAAGTCGGACCATAAGAAGGCTT
GTCTTGGATTGCCCTGGTTTCGCATCCACTCTCTTTAAGAAGGCCTTGTCTGGAAAATGTCGGTCGTGGGCTCAAGGACA
CTGTTCAAAGATACTATCTGCTTTCCTAGAGACTGAAGATTTTCAAGTTCGTGAGATGGCTAAAACAGAGCTTCAGGTGT
TGGTGAGTGAAGGTACTCTGAAAATCTCAGCAGCCAAGAAACCTGAATGA