Details for Lyrate rockcress Locus 16040498

Position : sca3 ( 5`- 7711508 .. 7713159 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040498

Protein [Map View]
MFQHAPSSISLIVFFFTILSPVSPNQEPVTVQPFRVKSSPPATIPAFPEQSDFFGCPLDLPEDLFHGIKSACSGKKLHKG
RCCPVLGAWLYSAYSTTALSRSISAAARNASSSSAAITTPEEDMPLLPDDSETCVDGLGKSLRQRGIELTRPNETCDVVY
CYCGIRLHPLSCSEAFRVNEEGRLVGDERVDRLETDCLSGSHNNADRFSPLLGCNKCLNSLYKLNPKKTSGTRNPSKEDR
NRTAKMHNKDCVLMGLTWLLAKNRTAYFPTVTSVLRAVMLNHDGVPRSCALGSDGMPLAVDSSEFSNGSPTSLQYWHHFL
LYSVITLVLL*

DNA
ATGTTCCAACACGCGCCTTCTTCCATTTCCCTCATCGTCTTCTTCTTCACCATTCTATCACCCGTTTCACCAAACCAAGA
ACCGGTCACAGTCCAGCCATTCCGGGTCAAATCATCCCCACCCGCAACCATTCCCGCTTTCCCGGAGCAATCCGATTTCT
TCGGCTGTCCACTTGATTTACCAGAAGACCTCTTCCACGGCATCAAATCAGCTTGTAGCGGTAAAAAGCTCCACAAAGGA
CGATGTTGCCCCGTACTAGGCGCGTGGCTCTACTCTGCTTACTCAACCACAGCTCTGAGCCGTTCGATTTCCGCCGCCGC
CAGAAACGCATCCTCCTCCTCCGCCGCGATAACGACGCCTGAAGAAGATATGCCTTTGCTTCCTGATGACTCTGAGACTT
GCGTTGACGGATTGGGGAAATCGCTGAGACAGAGAGGGATTGAGCTCACGAGACCGAACGAGACGTGCGACGTCGTTTAC
TGCTACTGTGGAATCAGATTGCATCCGTTGAGCTGTTCCGAGGCTTTTAGAGTGAACGAAGAAGGGAGACTCGTTGGAGA
CGAGAGGGTTGATAGATTAGAGACTGATTGTTTAAGTGGAAGCCACAACAATGCTGATAGATTCTCACCTCTACTTGGTT
GCAACAAGTGCTTGAACAGTCTCTATAAGCTAAACCCAAAGAAAACTTCAGGGACAAGAAACCCATCAAAGGAAGACCGA
AACAGAACAGCGAAGATGCATAACAAAGACTGTGTCCTCATGGGTCTTACTTGGCTTCTCGCTAAGAACCGTACTGCTTA
CTTTCCAACTGTAACTTCCGTCCTCCGAGCCGTCATGCTCAACCATGATGGCGTGCCACGTTCATGTGCTCTCGGCAGCG
ACGGCATGCCCTTAGCCGTCGACTCTTCGGAATTCTCCAACGGTTCGCCAACTTCACTTCAGTATTGGCACCACTTTTTA
CTATACAGCGTCATCACATTAGTCCTACTGTGA