Details for Lyrate rockcress Locus 16040484

Position : sca3 ( 5`- 8117482 .. 8121125 -3` )
Annotation : [B2G] catalytic coenzyme binding protein
External links : CoGe
PGDD synteny : 16040484

Protein [Map View]
MEGTCFLRGQPLTTIPSLPSRKGFLLQRWKTNRIVRFSGLKNHSVSGKSRSFDLSIRASGPIRASSAVTEANPANLNSKE
DDLVFVAGATGKVGSRTVRELLKLGFRVRAGVRSAQRAGSLVQSVKEMKLQNTDEGAQPVEKLEIVECDLEKKDSIQPAL
GNASVIICCIGASEKEISDITGPYRIDYLATKNLVDAATSAKVNNFILVTSLGTNKFGLPAAILNLFWGVLCWKRKAEEA
LIASGLNYAIVRPGGMERPTDAYKETHNLTLSLDDTLFGGQVSNLQVAELLACMAKNPQLSFSKIVEVVAETTAPLTSIE
KLLEKIPSKRPYVPPPKASVAAKEVKPVPTKPVTQEPTAPKEDEAPPKEKDVKPRPLSPYAAYEDLKPPTSPIPSSTTSV
GPAKSKEVDATQVLVEANVVPVPDSTSNVPVVEEEEVKQAVEEVEVMQAEEKKERPLSPYARYEDLKPPSLPSPTASGTK
KNDSLSPGPTDSDTDKSSTVATSVTETAVETSATETAVETSVTETAVETRVPETAAASSFTETAAPATPRMRPLSPYAVY
ADLKPPTSPTPASTGPKEAASEITASAEDNSELRGGNNDVLKTVDGSVNTTPSSSIPEAVTVVSNAVDTSLASEGNIAQP
KPRPLSPYTMYEDMKPPTSPLPSPVINH*

DNA
ATGGAAGGAACTTGTTTTCTCCGTGGGCAACCTCTAACAACAATACCATCTCTTCCCAGCAGAAAAGGGTTTCTTCTCCA
AAGATGGAAGACCAATCGTATTGTCAGGTTTTCTGGTTTAAAGAATCACTCGGTTTCTGGAAAGTCCAGGTCTTTCGATC
TTAGCATCAGGGCTTCAGGTCCTATAAGAGCAAGCTCTGCAGTAACAGAAGCAAACCCTGCTAACTTAAATTCCAAAGAA
GACGACCTTGTCTTTGTAGCCGGTGCTACTGGTAAAGTTGGTTCTAGAACTGTGAGAGAGCTACTGAAGCTTGGGTTTCG
GGTTAGAGCTGGAGTTCGAAGCGCTCAGAGAGCAGGAAGTCTTGTGCAAAGTGTTAAGGAAATGAAGCTCCAGAACACTG
ATGAAGGAGCTCAACCTGTAGAAAAGCTTGAAATTGTGGAGTGTGACTTGGAGAAGAAAGATTCAATACAGCCCGCATTG
GGAAATGCATCAGTGATTATATGCTGTATCGGTGCTAGCGAGAAAGAGATCTCTGATATTACTGGCCCATACAGGATTGA
TTACCTCGCCACCAAAAACCTTGTTGATGCTGCAACCTCTGCAAAAGTTAACAACTTCATTTTGGTGACATCCTTGGGGA
CAAATAAATTTGGACTTCCTGCTGCGATTCTCAACCTATTCTGGGGAGTTCTTTGCTGGAAGAGAAAAGCTGAAGAAGCG
TTGATTGCAAGCGGTCTCAATTACGCAATAGTTAGACCTGGGGGAATGGAGAGACCGACTGATGCATACAAAGAAACTCA
TAATCTCACTCTTTCTCTAGACGATACATTGTTTGGTGGTCAGGTCTCAAATCTCCAGGTTGCAGAGTTACTTGCTTGCA
TGGCAAAGAATCCTCAACTTTCTTTCTCCAAGATTGTGGAAGTGGTTGCTGAAACAACTGCACCATTAACTTCAATTGAG
AAGCTTCTTGAAAAGATTCCTTCCAAACGTCCTTATGTGCCTCCACCGAAGGCATCAGTTGCAGCTAAAGAGGTCAAACC
AGTCCCTACTAAGCCTGTCACTCAAGAGCCAACAGCTCCCAAGGAGGATGAAGCACCTCCAAAAGAAAAAGATGTGAAAC
CTAGGCCGCTGTCTCCTTATGCCGCCTACGAAGACTTGAAACCTCCAACATCTCCTATTCCAAGTTCGACCACATCAGTT
GGTCCTGCCAAATCTAAGGAAGTAGATGCCACTCAGGTTCTTGTTGAGGCCAATGTAGTGCCAGTGCCAGATAGTACCTC
AAATGTCCCAGTAGTAGAAGAAGAAGAAGTAAAACAAGCTGTAGAAGAAGTAGAAGTAATGCAAGCTGAGGAAAAGAAAG
AGAGGCCTCTTTCCCCTTATGCCCGCTACGAAGATCTAAAACCACCCTCATTGCCCTCTCCTACAGCTTCGGGTACCAAA
AAGAATGATTCTTTGTCGCCTGGTCCAACAGATTCTGATACTGATAAAAGCTCAACAGTTGCAACAAGTGTCACTGAGAC
AGCAGTTGAAACAAGTGCCACTGAGACAGCAGTTGAAACAAGTGTCACTGAGACAGCAGTTGAAACAAGAGTCCCTGAGA
CAGCAGCTGCATCAAGTTTCACTGAGACAGCAGCACCAGCCACACCAAGAATGAGGCCTCTTTCTCCTTATGCAGTTTAC
GCAGACCTGAAACCACCAACCTCACCAACTCCTGCATCAACTGGTCCCAAGGAAGCAGCATCTGAGATAACAGCATCTGC
AGAAGATAACTCAGAGTTGCGTGGAGGCAATAATGATGTGCTGAAAACAGTTGATGGAAGTGTGAACACTACTCCATCTT
CCTCTATACCGGAAGCAGTAACTGTTGTTAGCAATGCGGTAGACACTTCCCTTGCTTCAGAAGGCAATATAGCTCAGCCA
AAGCCAAGGCCCTTATCACCTTATACAATGTACGAGGACATGAAGCCTCCAACATCACCACTTCCTTCTCCAGTCATCAA
TCATTAG