Details for Lyrate rockcress Locus 16040480

Position : sca3 ( 5`- 1360850 .. 1361467 -3` )
Annotation : [B2G] mads-box family protein
External links : CoGe
PGDD synteny : 16040480

Protein [Map View]
MSTKQAKGRKTKGKQKIEMKKVENYGDRMITFSKRKAGIFKKMNELVAMCDVEVAFLIFSQAKKPYTFAHPSMQEVADRL
KNPSRQEPLAKDDTGPLVEAYKKRRFHDLIKKMEALEEELTMDLEKLKLLKESRNEKKLDKMWWNFPSKGLSVEELKQRH
QAIVELRDNLCDNMALLRLGKDGGSSSVRVGRRLSGGVRLFDREA*

DNA
ATGTCAACGAAGCAAGCAAAGGGAAGAAAAACAAAGGGGAAGCAAAAGATCGAGATGAAGAAGGTGGAAAACTATGGAGA
TAGGATGATTACGTTCTCGAAACGTAAAGCCGGAATTTTCAAGAAAATGAACGAGCTCGTAGCAATGTGTGACGTTGAAG
TGGCTTTCTTGATTTTCTCTCAAGCCAAGAAGCCGTATACATTCGCACATCCGTCTATGCAGGAAGTGGCTGACCGGTTA
AAGAACCCTTCGAGACAAGAACCATTAGCGAAAGATGATACGGGACCCCTCGTGGAAGCTTATAAGAAACGAAGGTTCCA
TGATCTCATAAAAAAAATGGAGGCGCTCGAGGAGGAGCTTACGATGGATCTAGAGAAGCTGAAACTGCTGAAGGAATCGA
GAAATGAAAAGAAGTTAGACAAAATGTGGTGGAACTTTCCTTCGAAAGGCTTGAGCGTGGAGGAGCTGAAGCAAAGGCAC
CAAGCGATTGTCGAGTTACGTGATAACTTATGCGACAATATGGCTCTCTTACGATTGGGAAAAGACGGTGGTTCATCTTC
TGTTCGTGTGGGACGTCGACTGTCTGGTGGTGTTCGTCTGTTCGATCGTGAAGCATGA