Details for Lyrate rockcress Locus 16040471

Position : sca3 ( 5`- 3335349 .. 3327837 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16040471

Protein [Map View]
MARQMTSSQFHKSKTLDNKYMLGDEIGKGAYARVYIGLDLENCDFVAIKQVSLENIGQEDLNTIMQEIDLLKNLNHKNIV
KYLGSLKTKTHLHIILEYVENGSLANIIKPNKFGPFPESLVTVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKL
ADFGVATKLNEADFNTHSVVGTPYWMAPEVIELSGVCAASDIWSVGCTIIELLTCVPPYYDLQPMPALYRIVQDDTPPIP
DSLSPDLTDFLRLCFKKDSRQRPDAKTLLSHPWIRNSKRALRSSLRHSGTIRYMKEPDSSSEKDDEGSQEVAESFSAEKV
EVTKTNSKSKLPVIGVESFRSEKDQSSPSDLGEEGTDAEDYLNSDLGPTLSTHDQSSRQSGTCSISSDAKGTSQDVLENH
ETSERDEIPGNLEKEASEGRRNTLATKLVGKEYSVQVAQSSHSFSQKGEVGLRKAVKTPSSFGGNELTRFSDPPGDASLH
DLFHSLDKVPEGKPNEASTSTPTTNVNQGDSPAADGGKNDLATKLRARIAQKQMEGETGHSQDGGDLFRLMMGVLKDDVL
NIDDLVFDEKVPPENLFPLQAVEFSRLVSSLRPDESEDAIVNSSLKLVAMFRQRRGQKAVFVTQHGFLPLMDLLDIPKSR
VICAVLQLINEIVKDNTDFLENACLVGLIPLVMSFAGFERDRSREIRKEAAYFLQQICQSSPLTLQMFIACRGIPVLVGF
LEADYAKHREMVHLAIDGMWQVFKLKRSTSRNDFCRIAAKNGILLRLVNTLYSLSEATRLASISGDALILDSQTPRARSG
QLDPNNPIFSQRETSPSVIDHPDGLKTRNGGGEEPSHALTSSSQRSDVHQPDALHLDGDRPRLSSVAADTTEDVIQQHRI
SLSANRTSTDKLQKLAEGASNGFPVTQPDQVRPLLSLLEKEPPSRKFSGQLDYVKHITGIERHESRLPLLYASDVKKTSG
DLEFIMAELAGISGRGKEKGNLDTAARYSSKTMTKKVMAIERVASACGIASQTVSSVLSGSGVLNARAGSTTSSGLLAHA
LSADVSMDYLEKVADLLLEFARAETTVKSYMCSQSLLSRLFQMFNRVEPPILLKILECTNHLSTDPNCLENLQRADAIKQ
LIPNLELKEGHLVYQIHHEVLSALFNLCKINKRRQEQAAENGIIPYLMLFVMSDSPLKQYALPLLCDMAHASRNSREQLR
AHGGLDVYLSLLDDEYWSVIALDSIAVCLAHDIDHKVEQAFLKKDAIQKLVNFFQNCPERHFVHILEPFLKIIMKSSSIN
KTLALNGLTPLLISRLDHQDAIARLNLLKLIKAVYEKHPKPKQLIVENDLPQKLQNLIEERRHGQRSGGQVLVKQMATSL
LKALHINTVL*

DNA
ATGGCGCGACAGATGACGTCATCCCAGTTCCACAAATCAAAGACTCTCGACAACAAATATATGCTTGGAGATGAAATTGG
TAAAGGAGCTTATGCTCGGGTTTATATAGGATTAGACCTGGAGAATTGTGACTTTGTTGCCATTAAACAAGTCTCTTTGG
AAAATATTGGTCAAGAGGATCTTAACACCATCATGCAAGAAATCGATCTCCTAAAGAACTTGAACCATAAAAACATTGTC
AAGTATCTTGGATCGTTGAAGACAAAGACTCACCTTCACATTATTCTGGAGTATGTTGAGAATGGCTCTCTTGCAAACAT
TATTAAACCAAATAAATTTGGACCTTTCCCTGAGTCGTTGGTGACTGTTTACATTGCACAGGTCTTGGAAGGTTTAGTAT
ATCTGCATGAGCAGGGTGTCATACATCGTGATATCAAGGGTGCAAATATTTTGACAACCAAGGAGGGCCTTGTTAAGCTT
GCTGATTTTGGAGTTGCCACAAAACTCAACGAGGCTGATTTCAACACTCACTCAGTGGTCGGAACTCCATACTGGATGGC
TCCGGAGGTTATTGAATTGTCAGGAGTTTGTGCTGCTTCTGACATTTGGAGTGTTGGGTGCACTATTATTGAACTTTTGA
CGTGTGTACCTCCTTACTATGATCTGCAACCCATGCCAGCCCTCTATCGCATTGTTCAGGATGATACCCCTCCCATTCCT
GATAGTCTATCTCCCGATCTTACAGACTTCCTACGACTGTGCTTCAAGAAGGATTCCAGGCAGAGGCCTGATGCAAAGAC
ACTTCTCTCGCACCCTTGGATACGTAACTCAAAACGAGCATTGCGGTCATCACTTCGGCATAGTGGAACCATCAGATATA
TGAAGGAACCCGATTCAAGTTCAGAGAAGGATGATGAAGGTAGTCAAGAAGTAGCTGAAAGCTTTTCAGCAGAAAAAGTG
GAGGTGACAAAAACTAACTCGAAAAGCAAATTGCCTGTTATAGGTGTGGAGAGTTTTAGGTCTGAGAAAGATCAGTCTTC
ACCCAGTGATCTCGGTGAAGAAGGAACGGATGCAGAAGATTATCTTAATTCAGATCTAGGTCCTACATTGTCTACGCACG
ATCAGTCTTCTCGTCAATCCGGTACTTGCAGTATTTCTTCGGATGCAAAGGGGACATCTCAAGATGTATTAGAGAACCAT
GAGACATCTGAACGTGATGAAATACCTGGAAATCTTGAAAAGGAAGCTTCTGAAGGTAGAAGGAATACTTTAGCAACAAA
GCTGGTTGGAAAAGAATATTCTGTCCAGGTGGCGCAGTCATCACATAGTTTTAGCCAAAAAGGTGAAGTTGGGCTTCGAA
AGGCTGTGAAGACTCCATCTAGTTTTGGTGGGAATGAACTGACCAGATTCAGTGATCCTCCTGGGGATGCTTCTTTGCAT
GATTTGTTTCATTCACTGGATAAAGTTCCTGAGGGAAAACCAAATGAAGCCTCAACATCGACGCCTACTACAAATGTAAA
TCAGGGTGATTCTCCTGCTGCAGATGGTGGAAAGAATGATCTGGCAACGAAATTGAGGGCTAGAATTGCTCAGAAGCAAA
TGGAGGGTGAAACGGGGCACTCTCAAGATGGTGGTGATCTTTTCCGCTTAATGATGGGTGTTTTGAAAGATGATGTTCTT
AACATCGATGACTTGGTATTTGATGAAAAAGTGCCCCCGGAGAATCTTTTTCCTCTGCAGGCAGTCGAGTTCAGCAGATT
GGTGAGCTCCTTAAGGCCAGATGAATCAGAAGATGCAATAGTAAATTCCTCTTTGAAACTTGTTGCCATGTTTCGTCAGA
GACGTGGGCAGAAAGCAGTATTTGTGACACAGCATGGTTTCCTCCCTCTAATGGATCTACTTGATATTCCTAAATCTCGA
GTAATATGTGCCGTGCTGCAGCTGATAAACGAAATTGTAAAAGATAATACCGACTTCCTGGAAAATGCTTGTCTCGTTGG
TCTTATTCCTTTGGTAATGAGTTTTGCTGGTTTTGAGAGGGATCGATCTCGAGAAATTCGTAAGGAAGCAGCCTACTTCT
TGCAGCAGATTTGTCAGTCAAGCCCCTTGACGTTGCAAATGTTCATAGCTTGCCGTGGAATACCCGTTTTGGTGGGATTT
CTTGAAGCAGATTATGCCAAACACAGGGAGATGGTTCACTTGGCTATTGATGGGATGTGGCAGGTATTTAAACTCAAAAG
ATCCACCTCTAGAAATGATTTCTGCCGTATTGCTGCAAAGAATGGAATTCTTCTTAGGCTAGTCAACACTCTATATAGCT
TGAGTGAGGCAACTCGACTGGCTTCTATATCAGGGGACGCATTGATTTTGGATAGTCAAACTCCACGAGCACGCTCTGGT
CAACTTGACCCTAACAATCCTATCTTTAGTCAGCGTGAGACTTCACCTAGTGTGATTGATCATCCTGATGGGTTGAAAAC
TAGGAATGGGGGTGGTGAAGAGCCTTCTCATGCTTTAACTTCAAGTTCTCAAAGATCAGATGTCCATCAACCCGATGCCT
TGCACCTAGATGGTGATAGGCCTAGATTAAGCAGTGTTGCAGCAGATACCACAGAAGATGTTATACAACAACATAGGATA
TCTCTTTCTGCCAATAGAACATCAACAGATAAGCTTCAGAAACTAGCGGAGGGTGCGTCTAATGGTTTTCCTGTTACTCA
GCCAGATCAAGTTCGACCTTTGCTTAGCTTATTAGAGAAAGAACCCCCTTCAAGAAAATTTTCTGGTCAACTGGATTACG
TGAAGCATATCACTGGCATAGAGAGACATGAAAGTAGACTTCCTCTTTTGTATGCATCAGACGTAAAGAAAACCAGTGGA
GACCTAGAATTTATAATGGCCGAATTAGCAGGAATCTCTGGACGTGGAAAGGAAAAGGGAAATCTCGATACTGCAGCTAG
ATATTCCAGTAAGACGATGACTAAGAAGGTTATGGCTATTGAAAGAGTCGCTTCTGCGTGTGGGATTGCATCTCAGACAG
TATCTAGTGTTCTGTCAGGTTCAGGTGTTTTAAATGCTAGAGCTGGAAGTACTACATCATCTGGTTTACTTGCCCATGCG
CTGAGTGCAGATGTCTCAATGGATTACTTGGAGAAAGTGGCTGATCTGCTTCTCGAATTTGCCCGAGCTGAAACGACAGT
AAAATCATACATGTGCAGCCAAAGCTTACTCAGTCGTCTTTTCCAGATGTTCAACCGTGTGGAACCTCCTATTCTGTTAA
AGATACTGGAATGCACCAATCATTTATCTACGGATCCAAATTGCTTGGAAAATCTTCAGCGTGCAGATGCAATTAAGCAA
TTGATCCCCAACCTTGAGCTTAAGGAAGGGCATCTTGTTTATCAGATCCATCATGAGGTACTTAGTGCACTATTCAACCT
CTGCAAGATAAACAAGAGGAGGCAGGAACAAGCGGCTGAAAATGGAATCATTCCGTACCTGATGCTCTTCGTCATGTCGG
ATTCTCCTCTGAAACAATATGCATTGCCACTACTATGTGATATGGCTCATGCATCTCGGAATTCAAGAGAGCAGTTAAGG
GCCCACGGCGGTCTGGATGTTTACCTGAGTTTACTCGATGATGAATATTGGTCCGTGATAGCCTTGGATTCAATTGCTGT
TTGCTTGGCGCATGACATTGACCACAAGGTTGAGCAGGCGTTTCTCAAGAAAGATGCAATTCAGAAATTAGTTAACTTCT
TCCAGAACTGTCCAGAAAGACATTTTGTGCACATTTTGGAGCCATTCTTGAAGATCATCATGAAATCATCTTCAATTAAT
AAGACATTAGCATTAAATGGATTGACTCCGCTACTTATTTCAAGACTAGACCACCAAGATGCGATTGCTCGACTTAACCT
CCTGAAACTCATTAAGGCTGTTTACGAGAAGCATCCAAAGCCAAAACAGCTGATCGTAGAGAACGATCTTCCTCAGAAAC
TGCAGAATCTGATTGAAGAACGACGTCATGGACAACGTTCAGGAGGCCAAGTTCTGGTGAAGCAAATGGCAACATCTCTC
CTCAAAGCACTTCACATCAACACCGTCTTGTGA