Details for Lyrate rockcress Locus 16040462

Position : sca3 ( 5`- 8610372 .. 8609088 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040462

Protein [Map View]
MDVSARKSQKAGREKLRREKLNEHFVELGNVLDPERPKNDKATILTDTVQLLKELTSEVNKLKSEYTALTDESRELTQEK
NDLREEKTSLKSEIENLNLQYQQRLRSMSPWGAAMDHTVMMAPPPSFPYPMPMAMPPGSIPMHPSMPSYTYFGTQNPSMI
PAPCPTYMPFMPPNTVVEQQSVHIPQNPGNRSREPRAKVSRESRSEKAEDSNEVATQLELKTPGSTSDKDTLQRPEKTKR
CKRNNNNNNNNSVEESSHSSKCSSSPSVRDHSSSSSVAGGQKPDDAK*

DNA
ATGGACGTTTCTGCTAGAAAGTCGCAAAAAGCAGGGCGCGAAAAGTTGAGGAGGGAAAAACTTAATGAGCATTTTGTTGA
ATTGGGAAATGTACTCGATCCAGAGAGACCCAAGAATGACAAAGCCACGATTCTGACTGATACTGTTCAGTTGTTGAAAG
AGCTCACATCTGAAGTCAACAAACTGAAATCTGAGTACACCGCATTGACAGATGAGTCCCGCGAGTTGACACAGGAGAAA
AACGACCTGAGAGAAGAAAAGACATCGCTGAAATCAGAGATAGAGAATCTCAATCTCCAATACCAGCAGAGATTAAGGTC
AATGTCTCCATGGGGAGCTGCGATGGATCACACAGTCATGATGGCTCCACCACCCTCCTTTCCATACCCAATGCCTATGG
CTATGCCTCCCGGGTCAATCCCAATGCATCCATCAATGCCATCTTATACATACTTTGGGACCCAGAACCCTAGCATGATC
CCAGCTCCATGTCCTACATACATGCCGTTCATGCCTCCTAATACAGTCGTTGAACAACAATCCGTGCACATTCCACAGAA
CCCGGGTAACCGTTCTCGGGAACCTAGAGCAAAGGTTTCAAGAGAGAGCAGATCTGAAAAAGCAGAGGACTCCAACGAAG
TTGCAACACAACTCGAGTTAAAAACCCCTGGATCGACTTCTGATAAGGATACATTGCAAAGGCCAGAGAAGACAAAGAGA
TGTAAGAGAAACAACAACAACAACAACAACAACTCCGTAGAAGAAAGCTCTCATTCTAGCAAATGTTCATCTTCTCCGAG
CGTACGAGACCACAGTTCTTCCAGTAGCGTAGCTGGTGGCCAAAAACCTGATGATGCAAAATGA