Details for Lyrate rockcress Locus 16040418

Position : sca3 ( 5`- 6817068 .. 6818502 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040418

Protein [Map View]
MENLWNRCSSSHQTPLAFKGNQKQIGQAHREVFTHFVSLPLAIYPELKKNIEAFQNSVLGNNDKNPLTFQTTLAEMGIEK
SIFVSPKTFHLTVVMLKLENNESVVKAQNILKSICSNVRQALKDRPVFIRLRGLDCMNGSLDKTRVLYVPVEEVGHEGRL
LNACHVIIDAFENAGFAGKDAKSRLKLHATVMNASYRKDKSKKMDTFDAREIHKEFENKDWGTYLIREAHISQRYKYDPN
GYFHCCASLPFPHK*

DNA
ATGGAGAATTTATGGAATCGTTGTTCCTCTTCTCATCAAACTCCTCTTGCCTTCAAAGGCAATCAGAAGCAGATTGGACA
GGCTCATAGAGAAGTGTTCACACACTTTGTGTCACTTCCATTAGCCATATACCCTGAGTTGAAGAAAAATATTGAGGCTT
TTCAGAACTCTGTATTGGGTAACAATGATAAGAATCCATTGACGTTTCAGACTACTTTAGCTGAAATGGGAATCGAAAAA
TCCATCTTTGTTTCGCCCAAAACTTTCCATTTGACTGTGGTTATGTTGAAGTTAGAGAACAATGAATCTGTGGTTAAAGC
TCAGAATATCCTTAAGAGTATTTGTTCTAATGTGAGGCAAGCTTTGAAGGACCGACCTGTCTTCATAAGACTCAGGGGAT
TGGATTGTATGAATGGATCTTTAGACAAAACCCGTGTTCTCTATGTTCCTGTTGAAGAAGTTGGGCATGAAGGTCGCCTG
CTAAATGCTTGTCATGTTATCATTGATGCATTTGAGAATGCTGGATTTGCTGGTAAAGACGCAAAGTCACGCTTGAAGCT
ACACGCCACAGTAATGAATGCAAGCTACAGAAAAGATAAAAGCAAAAAGATGGATACTTTTGATGCTCGAGAGATACACA
AAGAGTTTGAGAACAAGGATTGGGGAACATATCTAATCAGAGAAGCTCATATCTCACAACGCTATAAGTATGACCCTAAT
GGCTACTTCCATTGCTGTGCTTCACTACCTTTTCCACATAAGTGA