Details for Lyrate rockcress Locus 16040410

Position : sca3 ( 5`- 2851602 .. 2849322 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040410

Protein [Map View]
MSEDVWLTCLTHALSTETEEIMGLLLGDIEYSKNGERATAMIWAASPQSRSDRQKDRIHGLIMTISTGRTTRVIGWYHSH
PHITVLPSHVDVRTQAMYQLLDSGFIGLIFSCFSEDANKVGRIQVIAFQSSDGKPNSIPKSMSLVLANKDSVIDLESSFS
SSDSIYQRSSSARGDNPELDTTIAFYSSLMKVLTNYNFCIIQLIIQILKTIMGGGRVSDFGAFFVNNTEANITGRDGTSG
NYSSGNLSSTAIEIDSMDMSESMQEAMLRSNLETSGVGYVRKEVPLHVLPTSSLLQLNSPLASFKSLQRVLYEEERAAYH
QSVQQSMRDGRVHPLAFIHNTSTYQASMCKLIEYCLSPAINALQDRLKENKIRLAMLMDEAEVLEAQKLKGPETSGGPSR
LVHGSGSRSRRGS*

DNA
ATGTCCGAGGATGTGTGGTTGACTTGCCTCACTCACGCATTATCCACCGAGACCGAAGAAATCATGGGTCTCCTTCTCGG
CGACATCGAGTACTCAAAGAACGGCGAAAGGGCCACAGCTATGATCTGGGCAGCATCGCCTCAGTCACGATCTGATCGGC
AGAAGGATCGAATTCATGGTCTTATAATGACGATATCAACGGGCAGAACTACACGGGTGATTGGATGGTACCACTCCCAT
CCCCATATTACCGTTCTTCCTTCCCATGTCGATGTTCGGACACAAGCTATGTATCAGCTTTTAGATTCTGGTTTTATTGG
CCTCATATTTTCCTGTTTTAGTGAAGATGCTAACAAGGTTGGTAGAATCCAAGTTATCGCTTTCCAGTCTTCTGATGGAA
AGCCGAATAGTATTCCTAAATCAATGAGCCTGGTACTTGCTAATAAAGATTCTGTCATCGATTTAGAATCTTCATTTAGT
TCTTCGGACTCGATATACCAGAGATCCTCTTCTGCTCGGGGAGACAATCCCGAGCTAGACACAACTATAGCATTTTACTC
GAGCTTAATGAAAGTTTTGACAAATTATAATTTCTGCATAATACAACTCATTATTCAAATTCTCAAGACAATCATGGGTG
GAGGACGGGTTTCAGATTTTGGGGCTTTCTTTGTTAACAATACTGAGGCCAACATCACCGGCAGAGATGGAACTAGTGGA
AATTATAGCTCAGGCAATCTCAGCAGCACAGCTATAGAAATTGACTCCATGGACATGTCTGAAAGTATGCAAGAGGCAAT
GCTCCGTTCAAATTTAGAAACCAGTGGTGTGGGGTATGTTAGAAAAGAAGTCCCACTTCATGTTTTGCCAACTTCATCCC
TTCTTCAACTCAATTCACCTTTAGCATCTTTTAAAAGCCTGCAACGAGTACTCTACGAGGAGGAACGTGCAGCGTACCAC
CAATCGGTGCAGCAAAGCATGAGAGACGGGCGAGTTCATCCTCTTGCTTTCATTCACAACACATCAACATATCAAGCTTC
CATGTGCAAGTTAATCGAATACTGCTTGAGTCCTGCCATTAACGCACTTCAAGATAGGCTCAAGGAGAACAAGATCCGGT
TAGCAATGCTGATGGATGAAGCTGAGGTTTTGGAAGCACAGAAACTCAAAGGACCAGAGACAAGCGGGGGGCCATCTCGT
CTGGTTCACGGTTCTGGCAGCCGAAGCAGAAGAGGATCGTAG