Details for Lyrate rockcress Locus 16040409

Position : sca3 ( 5`- 10219271 .. 10218655 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040409

Protein [Map View]
MGVVFPTLIVYAFLLLFSLSSAASLQRLSGGLGQGKKETVRSGLPGQIVDQKRLGGGPGSVPPMCRLKCGKCEPCKAVHV
PVQPDLIAPLEYYPEAWRCKCGNKLFMP*

DNA
ATGGGCGTCGTCTTCCCAACTCTCATCGTATATGCTTTCCTTCTCCTTTTCTCGTTGTCCTCCGCCGCCTCTCTTCAACG
TCTCAGTGGAGGGCTTGGGCAGGGGAAGAAGGAGACAGTTAGGTCGGGTTTACCGGGTCAGATAGTAGATCAGAAGCGGT
TAGGCGGCGGTCCTGGCTCGGTGCCTCCGATGTGTAGATTGAAGTGCGGGAAGTGTGAGCCGTGTAAAGCAGTTCACGTT
CCGGTTCAACCAGATCTAATTGCGCCATTGGAGTACTACCCTGAAGCTTGGCGCTGCAAGTGTGGCAACAAACTCTTCAT
GCCCTAA