Details for Lyrate rockcress Locus 16040400

Position : sca5 ( 5`- 17845141 .. 17845921 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040400

Protein [Map View]
MPKNKKTEWQVGDPAISVVSDQFCNPYPMDLVVKRKVQNFSKDYYEVFDPSGNLLLQIDGQAWGFNRKRVMRDPAGFTIL
SMRQKGLALKNKWEVHGGESKEREDLLFTVQQSQAVSLKTSVDVFLPENNNVKKSNTCDFHASGGYSNISFKVFKSDALI
AGVGFTWGSFCKGKYNFKVRVNPEVDYAFIIALLVMVDDNENWC*

DNA
ATGCCGAAGAATAAAAAAACAGAATGGCAAGTAGGAGATCCCGCAATAAGCGTAGTGAGCGATCAATTCTGTAATCCATA
CCCAATGGATCTTGTGGTGAAGAGAAAAGTTCAGAATTTTTCTAAAGATTATTATGAAGTTTTTGATCCAAGTGGGAACC
TGCTCTTACAAATTGATGGACAAGCTTGGGGATTTAACCGTAAAAGAGTTATGCGTGATCCAGCCGGTTTCACAATCCTC
TCAATGCGCCAAAAGGGACTTGCGTTGAAGAACAAGTGGGAAGTGCATGGAGGAGAGAGCAAAGAGAGAGAAGACTTGCT
CTTCACGGTACAACAATCTCAAGCGGTTTCATTGAAAACATCCGTGGATGTTTTCTTGCCTGAGAACAACAATGTCAAGA
AGAGCAACACTTGTGATTTCCATGCTTCAGGAGGATACTCCAATATCTCATTCAAAGTTTTCAAATCGGATGCTCTCATC
GCCGGGGTAGGGTTTACATGGGGAAGTTTCTGCAAAGGGAAATATAATTTTAAGGTGAGAGTGAATCCAGAGGTTGATTA
TGCTTTTATCATTGCTTTGCTTGTTATGGTCGATGACAACGAGAACTGGTGTTAG