Details for Lyrate rockcress Locus 16040236

Position : sca3 ( 5`- 22265107 .. 22266567 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040236

Protein [Map View]
MSRCYPFPPPGYVRKESLIESIKGTKEEVKKDRKHKRKEKERKERENEAGRSRKHRHKRRRKDEGANASGSGKLINSEVE
FLEKSCQTVELELQTSSQTSCDSTLHSNERPKQIQSQSLDETGIRIRLPDKGQEDPEDEVMMTTKDQRSREMLDASLAAA
PKESVGHLYSTPRDAFRVCQEKVRDPAREKITKLGKEKKPIHPKDNRKISKEKKIPSSSSCTPLEQEKPSSSHQETIGSS
KLLCRKCPPSMAGQLLNLIEDWAPDRAESKLTDSEDQEWWLFIKFGAKRQQVSNQKTNQGSSLMVWPTARFLPEAEVHAL
PFTVPF*

DNA
ATGTCTCGGTGTTATCCGTTTCCACCACCTGGTTATGTTCGGAAAGAAAGTCTGATCGAATCGATCAAGGGGACAAAGGA
GGAAGTTAAGAAAGATAGAAAACACAAGAGGAAGGAAAAAGAGAGAAAGGAGAGGGAAAATGAGGCGGGTCGAAGTAGGA
AGCATCGGCATAAGAGACGGCGCAAAGATGAAGGCGCCAATGCTAGTGGTAGTGGCAAATTAATAAACAGCGAGGTCGAG
TTTTTAGAGAAGAGCTGCCAGACAGTGGAGCTTGAGCTGCAAACATCGTCTCAGACTTCTTGTGATAGCACTCTTCATAG
CAATGAGAGACCAAAGCAAATTCAGAGTCAGTCCCTTGATGAAACCGGCATACGGATCCGCTTACCTGACAAAGGGCAGG
AAGATCCTGAGGATGAGGTGATGATGACCACCAAGGATCAAAGATCCCGGGAAATGTTGGATGCTTCTCTGGCTGCTGCC
CCTAAAGAGTCTGTTGGTCATCTTTATTCGACTCCACGAGATGCTTTTAGGGTCTGTCAAGAGAAAGTAAGAGATCCAGC
CAGAGAAAAAATAACAAAACTCGGCAAAGAGAAGAAACCAATTCATCCGAAAGATAACAGAAAAATCAGTAAAGAGAAGA
AGATTCCATCATCATCTTCATGTACTCCTCTGGAACAAGAGAAACCATCCTCTAGTCATCAAGAAACCATTGGATCTTCA
AAGCTATTATGCAGGAAATGCCCTCCTTCTATGGCCGGGCAACTCTTGAATCTTATCGAGGACTGGGCTCCTGATCGGGC
TGAGAGCAAGCTCACAGACTCTGAAGATCAAGAATGGTGGTTGTTCATCAAGTTTGGAGCCAAAAGGCAACAAGTTAGCA
ATCAGAAAACCAACCAGGGAAGTAGTTTGATGGTGTGGCCAACTGCTAGATTTCTTCCGGAAGCCGAAGTACACGCATTG
CCATTCACTGTCCCATTCTGA