Details for Lyrate rockcress Locus 16040174

Position : sca3 ( 5`- 6436464 .. 6437922 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897824 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16040174

Protein [Map View]
MASLIDSVTVTRVFSLPIAASISSTSAGPSVSGRRISPVRFLEFRGLKCSRSLVTQSASLGANRRSRAARGGRIACEAQD
TTAAVEVPNLSDSEWQTQVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVPT
VIIFKDGEKKDSIIGAVPRETLEKTIERFLVE*

DNA
ATGGCGTCGTTGATCGATTCCGTCACCGTGACCCGCGTATTTTCTCTCCCGATTGCGGCTTCGATTTCATCTACTTCAGC
TGGTCCGTCGGTTTCAGGACGCCGGATTTCCCCAGTCAGGTTTCTGGAATTCAGAGGTTTGAAATGTTCGCGGAGTTTGG
TGACTCAGTCAGCGAGTCTTGGTGCGAATCGTAGATCCAGAGCTGCTCGCGGTGGAAGAATCGCTTGTGAGGCTCAGGAC
ACCACTGCTGCCGTCGAAGTACCAAACCTGTCTGATTCAGAATGGCAAACACAGGTTCTGGAATCAGATGTTCCAGTATT
GGTCGAGTTCTGGGCACCATGGTGTGGACCGTGCCGTATGATTCACCCCATAGTTGACCAACTGGCCAAGGATTTCGCAG
GGAAGTTCAAATTCTACAAAATCAACACCGACGAGAGCCCAAACACAGCGAACCGTTACGGGATACGCAGCGTTCCAACA
GTAATCATCTTCAAAGACGGTGAGAAGAAAGATAGTATCATTGGAGCTGTCCCTAGAGAGACATTGGAGAAAACTATAGA
AAGATTCTTGGTCGAGTAA