Details for Lyrate rockcress Locus 16040055

Position : sca3 ( 5`- 834680 .. 835176 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477546 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16040055

Protein [Map View]
MSGDGDKPAPAKLGDEQLAELREIFRSFDQNKDGSLTELELGSLLRSLGLKPSQDQLDTLIQKADRNSNGLVEFSEFVAL
VEPDLVKCPYTDDQLKAIFKMFDRDGNGYITAAELAHSMAKLEADRDGDGCIDFQEFVQAITSAAFDNAWG*

DNA
ATGAGCGGCGACGGAGATAAACCGGCGCCGGCGAAACTAGGCGACGAACAATTAGCGGAGCTTCGGGAGATTTTCCGATC
ATTTGACCAGAACAAGGATGGAAGTTTGACGGAGCTCGAGTTAGGCTCACTTCTAAGATCTCTCGGTCTAAAGCCGAGTC
AAGACCAACTCGACACCTTGATCCAGAAAGCAGATCGGAATAGCAACGGACTGGTCGAGTTCTCCGAGTTCGTCGCTCTC
GTCGAGCCAGATCTGGTCAAGTGTCCTTACACGGATGATCAGCTTAAAGCCATCTTTAAAATGTTTGACCGAGACGGAAA
CGGTTACATAACGGCGGCGGAGTTAGCTCATTCGATGGCGAAGCTAGAAGCTGATCGAGACGGCGATGGTTGTATCGATT
TCCAAGAGTTTGTTCAGGCGATTACTTCAGCTGCATTTGATAATGCTTGGGGTTGA