Details for Lyrate rockcress Locus 16040048

Position : sca3 ( 5`- 1483912 .. 1486373 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477698 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16040048

Protein [Map View]
MQQAMLPHKDEKVRKALEKTRELGIADEKTMPVLMKLLEEADGHWSLIKLDNYTALVDAILSVEEEKKQCEGSSNGNRGK
NLKVIGSPASLKKTYETRSASSGSSIQVVQKQPQISNGDRKRKYKSRISDITKGSESVKISLVDDVGSEAVPKFTYIPHN
IVYQSAYLHVSLARISDEDCCANCKGNCLSADVPCTCARETSGEYAYTKEGLLKEKFLDTCLKMKKEPDTFPKVYCKDCP
LEKDHDKGTYGKCDGHLIRKFIKECWRKCGCDMQCGNRVVQRGIRCELQVYFTQEGKGWGLRTLQDLPKGTFICEYIGEV
LTNTELYDRNVRSSSERHTYPVTLDADWGSEKDLKDEEALCLDATICGNVARFINHRCEDANMIDIPVEIETPDRHYYHI
AFFTLRDVKAMDELTWDYMIDFNDKSHPVKAFRCCCGSESCRDRKIEGSQGKSLERRRIVPAKKQQGSKAVALKRK*

DNA
ATGCAACAAGCGATGCTCCCCCATAAAGACGAGAAGGTACGCAAAGCTTTAGAGAAAACAAGGGAATTGGGTATTGCCGA
TGAAAAGACAATGCCAGTGCTTATGAAGCTCCTAGAAGAGGCTGATGGCCATTGGTCATTAATAAAATTGGATAACTATA
CTGCACTTGTCGACGCTATTCTCTCTGTTGAGGAAGAGAAGAAGCAATGTGAAGGTTCATCTAATGGCAATAGAGGGAAG
AATCTTAAGGTCATTGGCTCTCCTGCTTCTCTGAAAAAAACTTACGAAACCCGTTCTGCATCCTCAGGTTCGTCCATTCA
GGTAGTCCAGAAGCAGCCACAGATTAGCAATGGTGATCGCAAGAGGAAATATAAAAGCAGAATTTCTGACATAACTAAAG
GTTCAGAGAGCGTTAAAATATCTCTTGTCGATGATGTTGGGAGTGAAGCTGTGCCTAAGTTTACTTACATCCCTCACAAT
ATTGTATACCAAAGTGCTTATCTCCACGTGTCTCTGGCTCGAATTTCTGATGAAGATTGCTGCGCGAACTGCAAAGGGAA
CTGTCTTTCAGCTGACGTTCCTTGCACTTGTGCTCGTGAAACCAGTGGAGAATATGCTTATACCAAAGAAGGGTTGCTAA
AGGAAAAGTTTCTGGACACCTGTCTTAAGATGAAAAAGGAACCAGATACGTTCCCTAAAGTTTACTGCAAAGACTGCCCT
TTGGAGAAAGATCACGATAAGGGCACATATGGAAAATGTGATGGACACTTAATCCGGAAGTTCATCAAGGAATGCTGGAG
AAAGTGTGGATGTGATATGCAGTGTGGAAATCGAGTAGTACAGAGAGGGATAAGGTGCGAACTGCAGGTTTACTTTACTC
AAGAAGGGAAAGGATGGGGTCTTAGAACACTGCAAGACTTGCCGAAAGGAACCTTTATCTGTGAATACATTGGTGAAGTA
TTGACCAACACGGAGTTATACGACCGGAATGTAAGGTCTAGTAGTGAACGGCATACATATCCTGTAACTCTGGATGCAGA
CTGGGGTTCTGAAAAGGATCTAAAAGATGAAGAAGCTCTCTGCCTGGATGCCACAATCTGTGGAAATGTCGCAAGGTTTA
TCAATCACAGATGCGAGGATGCAAACATGATTGATATTCCGGTAGAAATAGAGACGCCTGACAGACATTATTATCATATT
GCCTTTTTTACCCTACGGGACGTGAAGGCCATGGATGAGTTGACATGGGATTACATGATAGACTTCAATGATAAAAGTCA
TCCTGTAAAGGCATTTAGATGTTGCTGCGGAAGCGAATCATGCAGAGACAGAAAAATAGAAGGATCTCAAGGCAAGTCTT
TAGAGAGAAGAAGGATTGTTCCTGCTAAAAAACAACAAGGTTCCAAAGCGGTGGCTTTAAAGCGCAAATGA