Details for Lyrate rockcress Locus 16040045

Position : sca3 ( 5`- 3024657 .. 3026307 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040045

Protein [Map View]
MYADKLEAESGSRKVVKDRINGGSGDISSRVRQVTGKRQRQDDKWEHDLFSSDKPQLSNRRVDPRDLRLKLQKRHHVSQS
GREAGSGVRDLREKLSGTMNLQPKNSDAPKPKVEAARPSMKSVATETETRKTSTQATRKKSQQADSSVDSFLESLGLEKY
STAFQVEEVDMDALMHMTDDDLKAMLIPMGPRKKILLALGSKP*

DNA
ATGTATGCTGATAAATTGGAGGCTGAGTCTGGAAGCAGGAAGGTCGTTAAGGATCGTATCAATGGCGGTTCTGGCGACAT
CTCTTCTCGCGTGCGACAAGTGACTGGGAAGAGGCAAAGGCAGGACGACAAATGGGAGCATGATCTTTTCAGTAGTGACA
AACCTCAACTTTCAAATCGCAGAGTTGATCCTAGAGATCTTCGTTTGAAGCTCCAAAAGAGACATCATGTGTCTCAAAGT
GGGCGAGAAGCTGGTTCAGGCGTGCGGGATTTACGGGAAAAGCTCTCTGGGACAATGAATCTGCAACCAAAAAACAGTGA
TGCGCCAAAACCTAAAGTGGAGGCTGCTAGACCAAGTATGAAGAGCGTAGCGACTGAAACAGAGACTAGAAAAACTTCCA
CTCAAGCTACCAGGAAGAAATCACAGCAGGCTGATTCATCGGTTGATAGCTTTCTGGAATCATTGGGTCTCGAGAAATAT
TCAACAGCTTTTCAAGTGGAAGAAGTTGATATGGATGCTCTCATGCATATGACAGATGATGACCTCAAGGCTATGCTCAT
ACCGATGGGTCCGAGGAAGAAGATACTGCTTGCTTTGGGATCTAAACCCTAA