Details for Lyrate rockcress Locus 16040034

Position : sca3 ( 5`- 5738255 .. 5742452 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478800 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16040034

Protein [Map View]
MASRIINHSKKLKHVSALLRRDHAVAVRCFSNSTQPSLIGKEDIFKARLNYSSVERISKCVTGNVTMLSGISTTSTKLSS
TMAGPKLFKELISSQMRSVRGFSSSSDLPPHQEIGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECM
EEGFLAKIVKEEGAKEIQVGEVIAITVEDEEDIQKFKDYTPSSGTGPAAPEAKPAPSPPKEEKVEKPASAPEAKISKPSS
APSEDRIFASPLARKLAEDNNVPLSSIKGTGPEGRIVKADVEDFLASGSKETTARPSKQVDSKVPALDYVDIPHTQIRKV
TASRLAFSKQTIPHYYLTVDTCVDKMMGLRSQLNSFQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFKNV
NINVAVQTENGLYVPVVKDADKKGLSAIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAVINPPQAAIL
AIGSAEKRVVPGAGPDQYNVASYMSVTLSCDHRVIDGAIGAEWLKAFKGYIETPESMLL*

DNA
ATGGCTTCTCGTATCATCAATCATTCCAAAAAGTTGAAACATGTTTCTGCCTTACTGCGGCGTGACCATGCTGTGGCAGT
CCGCTGTTTCTCCAACAGTACCCAGCCCTCTCTCATTGGAAAAGAAGATATCTTCAAGGCCCGCCTGAATTATTCCTCTG
TAGAGAGAATTTCAAAATGTGTTACTGGCAATGTAACAATGCTTAGTGGTATTTCAACAACGAGCACGAAACTAAGCAGC
ACAATGGCAGGACCAAAACTATTTAAAGAACTTATAAGCTCCCAGATGCGATCAGTGAGAGGATTTTCATCCAGTTCAGA
TCTTCCTCCTCATCAAGAGATTGGAATGCCTTCTCTTTCGCCAACAATGACTGAGGGTAACATTGCCAGGTGGCTGAAGA
AAGAGGGTGATAAAGTTGCTCCTGGTGAAGTGCTTTGTGAAGTTGAAACTGACAAAGCAACAGTCGAAATGGAATGCATG
GAAGAGGGTTTTCTCGCCAAGATAGTAAAGGAGGAGGGGGCAAAAGAAATTCAAGTTGGGGAGGTGATTGCTATCACAGT
TGAAGATGAAGAGGATATTCAAAAGTTTAAAGATTACACACCCTCATCCGGTACTGGTCCCGCTGCGCCTGAAGCAAAAC
CAGCTCCTTCCCCACCAAAGGAAGAGAAGGTAGAGAAGCCAGCCAGTGCTCCTGAAGCCAAGATATCTAAGCCAAGCTCG
GCTCCTTCAGAAGATCGTATTTTTGCCAGTCCTCTTGCAAGAAAGTTGGCTGAAGATAATAATGTACCTCTCTCAAGCAT
TAAAGGCACAGGTCCTGAAGGACGGATAGTGAAGGCTGATGTCGAAGATTTCTTAGCTTCAGGCAGTAAAGAAACTACTG
CCAGACCTTCCAAGCAAGTGGATTCTAAGGTTCCAGCTCTGGACTATGTTGACATACCTCACACTCAGATACGAAAGGTC
ACAGCCTCACGTTTGGCATTCTCAAAGCAAACTATTCCTCACTACTACTTGACCGTGGATACATGTGTTGACAAAATGAT
GGGTCTTAGGAGTCAACTCAATTCATTTCAAGAGGCTTCCGGTGGGAAACGGATATCTGTGAATGATCTTGTTATTAAGG
CTGCTGCACTGGCTCTTCGAAAAGTTCCTCAGTGCAATAGTTCATGGACAGACGAATACATCCGCCAATTTAAAAATGTG
AACATCAATGTCGCTGTACAAACAGAAAATGGGCTCTACGTTCCTGTGGTCAAGGACGCGGATAAGAAAGGACTGTCCGC
AATAGGAGAAGAGGTGCGATTCTTGGCTCAAAAAGCAAAAGAAAATAGCTTGAAGCCGGAAGATTATGAGGGAGGAACAT
TCACAGTCTCCAACCTGGGAGGACCATTTGGCATCAAACAGTTCTGTGCCGTCATCAATCCACCTCAAGCCGCCATTCTA
GCAATCGGATCCGCTGAAAAGAGAGTTGTTCCCGGTGCTGGTCCTGACCAATACAACGTTGCTTCATACATGTCTGTAAC
ACTAAGCTGTGACCACCGTGTAATAGATGGTGCAATTGGAGCCGAGTGGCTGAAAGCATTCAAGGGATACATCGAGACCC
CAGAATCTATGTTGCTGTAA