Details for Lyrate rockcress Locus 16040027

Position : sca3 ( 5`- 3667560 .. 3668790 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040027

Protein [Map View]
MALHGSGVLCKVSNMVEITSLFGGSMRLLHLPKSYPIHCNMVSASNTFGSGHLKLQNKEPCSRFRPCRVKREDNNQTADV
KSISVDETTLKQDLETAIQEENYVEAAKIRDKLKELQEDNKASVLSANSRFYQSFRNGDLAAMQSLWSKSGNPCCVHPGA
KGITGYDYVMESWEFVWMNYEFPLQIELKDVEVHVRGEVGYVTCMEFVKTKGSSSWGAQFVSNVFERIDGQWFICIHHAS
PVDI*

DNA
ATGGCGCTTCATGGGTCTGGAGTTTTATGCAAAGTTTCAAACATGGTAGAGATCACTTCTCTGTTTGGTGGTTCGATGAG
GCTGCTTCACTTGCCTAAATCTTATCCGATTCATTGCAACATGGTTTCAGCTAGCAATACATTCGGTTCTGGTCATCTCA
AGCTGCAAAACAAAGAACCGTGCTCCCGTTTTAGGCCTTGTCGAGTCAAACGTGAAGACAATAACCAAACTGCGGATGTT
AAAAGCATTTCAGTAGATGAGACCACGTTGAAGCAAGATCTCGAGACTGCGATCCAGGAAGAAAACTATGTGGAGGCAGC
TAAAATCCGGGATAAACTAAAAGAGCTTCAAGAAGACAACAAAGCCTCTGTTTTATCAGCCAATTCTCGGTTCTACCAAT
CTTTCAGAAACGGGGATTTAGCTGCAATGCAATCTTTGTGGTCAAAATCCGGAAACCCGTGCTGTGTGCATCCAGGGGCC
AAAGGCATAACTGGGTATGATTACGTGATGGAAAGCTGGGAATTTGTGTGGATGAACTACGAGTTTCCGTTACAGATTGA
GCTGAAGGATGTTGAGGTTCATGTCCGAGGCGAAGTAGGTTATGTAACGTGTATGGAGTTTGTGAAGACGAAAGGGAGTA
GTAGTTGGGGAGCTCAGTTTGTGTCGAATGTGTTTGAACGGATCGATGGGCAATGGTTTATATGCATTCACCATGCTTCT
CCTGTTGATATTTGA