Details for Lyrate rockcress Locus 16040022

Position : sca3 ( 5`- 1549614 .. 1550548 -3` )
Annotation : [B2G] phosphoenolpyruvate carboxylase kinase 2
External links : CoGe
PGDD synteny : 16040022

Protein [Map View]
MTGEFELENNYQLCDEIGRGRFGTITRCFSPATKEFYACKTIDKRVLVDALDRECIETEPRIMAMLPPHPNIIRIFDLYE
TEDSLAIVMELVDPPMTIYDRLISAGGRLSESESASNAKQILRALAHCHRCDVVHRDVKPDNVLVDLVSGCVKLCDFGSA
VWLGGETAEGVVGTPYYVAPEVVMGRKYEEKVDIWSAGVVIYTMLAGEPPFNGETAEEIFESILRGNLRFPPKKFGSVSS
EAKDLLRKMICRDVSRRFSAEDALRHSWLMNVGNLQSK*

DNA
ATGACCGGAGAATTCGAACTGGAAAATAACTACCAGCTTTGCGACGAGATCGGTCGAGGTCGATTCGGAACAATCACTCG
CTGTTTCTCACCGGCGACTAAAGAATTCTACGCCTGCAAAACCATCGACAAGCGCGTGCTCGTTGACGCGCTGGATCGCG
AGTGTATAGAGACGGAGCCGAGGATCATGGCGATGTTACCGCCGCATCCGAATATAATCAGGATCTTCGATCTCTACGAA
ACAGAGGATTCTCTAGCGATCGTCATGGAATTAGTCGATCCGCCGATGACGATTTACGATCGGTTAATCTCCGCCGGGGG
ACGGTTATCGGAATCGGAATCTGCTTCAAACGCGAAACAGATCCTCCGTGCGCTTGCTCATTGTCACCGGTGCGACGTCG
TTCATCGGGATGTGAAACCTGACAACGTCTTAGTCGATCTCGTAAGCGGCTGCGTTAAGCTCTGTGATTTCGGATCAGCG
GTGTGGTTAGGCGGAGAAACTGCGGAGGGAGTTGTGGGAACACCGTATTACGTGGCGCCGGAAGTAGTGATGGGAAGGAA
GTACGAGGAGAAGGTTGATATATGGAGCGCCGGTGTAGTGATCTACACGATGTTAGCTGGTGAGCCGCCGTTTAACGGTG
AGACGGCGGAAGAGATCTTTGAATCGATCTTGAGAGGGAATTTGAGGTTTCCGCCGAAGAAATTTGGATCGGTATCATCG
GAAGCGAAGGATTTGTTGAGGAAAATGATATGTCGCGATGTTTCTCGGCGATTTTCTGCAGAAGATGCTCTTCGACATTC
ATGGCTGATGAACGTTGGAAACCTCCAAAGCAAATAA