Details for Lyrate rockcress Locus 16040020

Position : sca3 ( 5`- 5325036 .. 5322003 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040020

Protein [Map View]
MSSSSCDGGSRVSIPADLLETIQNIREVTGKQHSDEDIFSVFKECFNDPHETTQKLLFLDTFHEVRSKRERKKENLVPNT
QGRGRTGRRNFASSYTDASNGRTAAFKKQSGANHIIGGSGTASSAPNNARNDTKPSSIMAPNPINLPSGISNHKLQDAII
SPVNKGVTEEQPLPKSTSLSEDVVEPDKSKASTVPVAVSDSVVENDVYGTSQIPQPSERVIKSEVAANKGKNQSLLKSDV
GEQPHVTFPVHLQVAKMLENGLTFGSFDSNFVREASSDNCTIGCDDSNSESSHGTAAYGASVRKDVSTFSQDKNHEISNS
AAQKELTLQPDQTVLSVDGSEGDKVKDEFLPITDTHQAAKCDAPLISYPDQYSIAAAQQAMHLRQQYSLNFFPYGPYFPP
YYMPQPYIHQYLSPNGFQQQSYLPPRDDASAPPGAELPLTHIKPGSEIGNSPPTTIPFPYALYAFNHIPSAATVNTTHKE
EKKENIYTTGPLSLANLQASPMYNFSLQGHPIAFPTIQPGIPGIYQQTQPVLAPPTISTRTEPIGPSHITNQQPQAALTN
LGNNY*

DNA
ATGAGCAGCAGCAGCTGCGATGGCGGCTCTAGGGTTTCGATTCCGGCCGATTTGCTTGAAACCATTCAAAACATCAGAGA
GGTTACCGGTAAACAACATTCCGACGAGGATATCTTCTCTGTCTTTAAGGAGTGTTTCAATGATCCACATGAGACCACTC
AGAAGCTCCTCTTTTTAGATACATTTCATGAGGTGAGAAGCAAACGGGAGAGAAAGAAAGAGAATTTAGTGCCAAATACA
CAAGGAAGGGGCCGGACTGGACGGAGGAACTTTGCTTCAAGTTACACAGATGCCAGTAATGGAAGAACTGCAGCTTTTAA
AAAGCAGAGTGGAGCTAATCACATAATAGGAGGTTCTGGAACTGCTTCTTCTGCTCCTAACAATGCAAGAAACGACACAA
AACCTTCTTCCATAATGGCCCCTAACCCTATAAATCTTCCAAGTGGAATCAGTAACCATAAACTTCAAGATGCTATCATC
TCCCCTGTGAACAAGGGAGTCACAGAGGAACAGCCTCTCCCCAAGTCTACTTCTTTGTCTGAAGATGTTGTTGAGCCGGA
TAAGTCTAAAGCAAGTACTGTACCAGTGGCTGTATCAGATTCTGTTGTAGAGAACGATGTATATGGAACTTCTCAGATCC
CACAACCGTCAGAGCGAGTCATTAAGAGTGAGGTTGCAGCCAATAAAGGCAAGAATCAGTCGCTTCTCAAGTCAGATGTT
GGTGAACAGCCACACGTAACATTTCCTGTCCACCTTCAGGTTGCCAAAATGCTGGAAAATGGTCTGACATTTGGGAGCTT
CGATTCTAATTTTGTGAGAGAGGCATCTTCTGACAATTGTACTATTGGGTGTGATGACTCCAATAGTGAGTCTTCTCATG
GGACAGCGGCCTATGGGGCATCAGTTAGGAAAGATGTATCAACTTTTTCTCAGGATAAGAATCATGAGATTTCAAATTCA
GCAGCTCAGAAGGAGCTAACATTGCAGCCAGATCAAACTGTTCTCTCTGTAGACGGTTCAGAAGGAGATAAAGTAAAGGA
CGAGTTTTTACCAATCACAGACACTCATCAGGCTGCAAAGTGTGATGCTCCACTGATCTCCTACCCTGACCAGTATTCCA
TAGCTGCCGCTCAACAGGCAATGCACCTTAGGCAACAATACTCTCTAAACTTTTTCCCTTATGGTCCATATTTCCCCCCC
TATTATATGCCGCAACCATACATTCACCAGTACTTGAGCCCAAACGGGTTCCAACAACAGTCTTACTTACCACCCAGAGA
TGATGCTTCAGCACCTCCAGGGGCTGAACTACCTCTCACTCACATCAAACCAGGAAGCGAGATTGGCAACTCTCCACCTA
CCACAATTCCATTCCCATATGCTTTATACGCTTTCAACCACATCCCATCAGCAGCCACCGTAAACACCACCCACAAGGAA
GAAAAGAAGGAAAACATTTATACAACTGGACCACTGAGTCTAGCCAATCTGCAGGCCAGTCCCATGTACAACTTTTCCCT
TCAAGGTCACCCAATAGCTTTCCCAACCATTCAGCCTGGGATCCCGGGAATATACCAACAAACACAGCCCGTACTGGCGC
CTCCTACTATATCTACGAGGACTGAACCCATAGGACCCTCACACATAACTAATCAGCAACCTCAAGCCGCACTAACAAAT
CTGGGGAACAACTACTAG