Details for Lyrate rockcress Locus 16040015

Position : sca3 ( 5`- 5390098 .. 5379663 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16040015

Protein [Map View]
MHLYNEWLPPPVAEETKKEKESFARVVRCVKELHRPDDPESVYATLKWISVIELFVRAKSELSVEDVSELVEIGLQIFHS
SENKLYAQVRWGNVLVRLINKYRKKLSLKVQWRPLYDTLIHAHFSRSLLENPWHNSSFEGSGFVRLFLPTNPGNQDFFSD
FIDWESYFPMLFSRFLNMFEVPVANGSGSYPFSVDVPRNTRFLFSNRTTTPSKSIAQSIVYFLKPGSTAHEQFEKLVNLL
EQYYHPSNGGRWTYSLERFLLHLVIAFQKRLQREQQSYSYRDPDSLPAVCLGKPERIAFVGVVLKLIDRGQYSKNEHLSE
TVAAATSMLSYVEPSLVLPFVASRFHLALETTTATHQLKTAMMSVAFAGRSILQSSMSTAKAQDLGGDVDDRMFLDLIGI
SLSNALLGMDANDPPKTLATMQLIGSIFSNMAVLDDSSDDLSFMTMDSFSEWLDEFLCRLIALLQHLEPNSVINEGLSSS
ATSGTFLVEDGPYYYCMLEILLGRLSGSLYNQALRKISKFVQTNILPGAIAEVGLLCCACVHSNPEEAVAQIVEPMLLAV
ISSLKEIPVTGYGGKGSAETRVSNKQDKHTLSPALEAAIDYQLKVLSVAITYGGISLLRYKGHLIEAISSAFNSSSWKVN
GAGDHLLRSLLGSLILYYPIDQYKCLSRHPAASALEEWISTKASSKDEQVAHSRWHVPTKEETQFANELLDLHLQSALDD
LLSICQSNIHSDAGDEKTHLKVTLLRIDSTLQGVLSCLPDFRPSPRHDMVEDLPFFIAGASGSCVGSAEIREKTAKTIHA
ACKYLLEKKSDDSILLILIIRIMDALGNYGSLEYDEWSNHRQAWKLESAAIVEPPANFITEFNSKGKRRPRWALIDKAYM
HNTWRSSQSSYHLFRTDGNFSPPEALTLLVDDLLTLCLHNYETVRVLSGKSLLKLLKRWPTLLSKCVLSLTENLRKPDVE
ENVVLGSCAILSSQSVLKHLTTLFVKYNIHFAGLSRNILRSLESHVEGSTSGDLVSQIGSMSFDSSSLHWRYNLMANRVL
LLLVMSSRIDPSFSFKILDETAGHFLKNLKSQLPQTRILAISALNTLLKESPHKMQGKDQPSVSSQEIENANSSLDLALS
QIFREEGFFKETFESLSHIHVTDTDSSSRGNHGSSSFQSMADKSITRFYFEFSASWPRTPSWISLLGSDIFYPSFARIFK
RLAQECGVPVLLALKSPLEEFCNAKERPKQCVAAEALAGVLHSDVNGLLGEWDSWIMVQLQNVILGQSVESIPEWAACIR
YAVTGKGKQGTKIPVMRQQILDCIVAPLPPTATTTVVAKRYAFLSAALIELSPPKMPVSEVKLHIVLLDELICNMSHSSA
QIREAIGVILSVLCSNIRLRMSYQQEHPSEEGRTDVDSQLKEENWFKLIGAKASEAVKNIQQASISDSLDTSADVDMENA
QSNGDSLDDVKWMETLFHFIISSFKSGRASYLLDVIAGFLYPVISLQETSHKDLSILAKAAFELLKWRVFPESHLPKVIG
VILSSADDSNWRIRSSTLTYLRTFMYRHTFILSHEDKQKIWKTVEKLLVDSQVEVREHAAAVLAGLMKGGDEDFAADFRD
RSYTEANSIQKRRNRRKASSTQSIAEVHGAVLGLVASVLSVPYDMPSWLPDHVTLLARFAGEPTPIKSTVTKAVAEFRRT
HADTWNIQKDSFTEDQLEILTDTSSSSSYFA*

DNA
ATGCATCTGTACAATGAATGGCTACCGCCGCCTGTAGCGGAGGAGACGAAGAAGGAGAAAGAGTCCTTCGCTCGTGTCGT
GAGATGCGTCAAAGAGTTGCACCGACCCGATGATCCAGAGTCTGTTTACGCCACTCTTAAATGGATCTCCGTTATCGAAC
TCTTTGTTAGAGCGAAAAGTGAATTGTCCGTGGAAGATGTTAGTGAACTCGTGGAAATTGGCTTACAAATTTTTCATTCA
TCTGAGAATAAGTTGTATGCACAGGTTAGATGGGGTAATGTTTTAGTCAGACTGATCAACAAGTATCGTAAGAAGCTGTC
TTTGAAAGTTCAGTGGAGGCCCTTGTATGATACCTTGATTCATGCACATTTCAGCAGGTCTCTTTTGGAGAATCCTTGGC
ATAATTCCTCGTTTGAGGGCTCTGGTTTTGTGAGATTGTTCCTTCCTACGAACCCTGGAAATCAGGATTTCTTCTCCGAC
TTTATCGACTGGGAGTCGTACTTTCCCATGCTTTTCAGTAGATTCTTGAATATGTTTGAGGTTCCTGTTGCAAATGGGAG
TGGATCATATCCTTTTTCAGTTGATGTTCCCAGAAACACAAGATTCTTGTTCTCTAACAGGACTACTACTCCATCAAAAT
CAATTGCACAATCTATTGTATACTTTCTAAAACCTGGAAGTACGGCACATGAGCAGTTCGAGAAGTTGGTCAACCTCTTA
GAACAGTATTATCATCCTTCTAATGGTGGCCGTTGGACTTATTCCTTGGAACGGTTTTTGCTTCACCTGGTGATAGCTTT
CCAAAAGCGTTTACAGCGTGAGCAGCAATCCTATTCCTACAGAGATCCAGATAGTCTGCCAGCAGTCTGTTTAGGAAAGC
CGGAAAGGATAGCTTTTGTTGGCGTGGTGTTGAAGTTGATTGATCGTGGCCAATATAGCAAGAATGAACATCTTTCCGAG
ACAGTTGCTGCAGCGACATCCATGTTATCTTATGTGGAGCCTTCTTTGGTCCTTCCTTTTGTGGCGTCTCGGTTCCATTT
GGCTTTGGAAACGACAACTGCCACCCACCAGCTGAAAACTGCTATGATGTCCGTAGCTTTTGCTGGCCGGTCAATCCTGC
AGTCTTCCATGTCAACTGCTAAAGCACAAGATCTTGGTGGTGATGTGGACGATAGGATGTTTCTTGATCTTATTGGGATT
TCTCTATCAAATGCATTGCTTGGTATGGATGCCAATGACCCCCCTAAAACCTTGGCAACTATGCAACTGATTGGCTCCAT
ATTTTCCAATATGGCTGTTTTGGACGATAGTTCTGATGACTTATCATTCATGACAATGGATTCCTTCTCTGAGTGGCTGG
ATGAATTTTTGTGTCGTTTGATTGCTTTGTTACAGCATTTGGAACCCAACAGTGTTATAAATGAAGGCCTAAGTTCATCT
GCAACATCAGGAACGTTTTTGGTTGAGGATGGTCCATATTACTATTGCATGCTTGAAATCCTACTTGGAAGGCTATCTGG
ATCTCTATATAACCAGGCCTTGAGAAAGATATCAAAATTTGTTCAGACAAATATCCTTCCTGGTGCAATTGCTGAGGTTG
GGTTGCTTTGTTGTGCCTGTGTTCATTCCAACCCCGAAGAAGCAGTTGCTCAAATTGTTGAACCAATGCTCCTTGCTGTT
ATATCTTCTCTGAAAGAAATCCCTGTCACTGGGTATGGAGGAAAAGGAAGTGCAGAGACCCGTGTTTCCAATAAGCAAGA
CAAACACACACTTTCTCCAGCGCTTGAGGCAGCTATAGATTATCAGCTGAAAGTATTGTCAGTTGCGATCACTTATGGAG
GCATCTCACTTCTTCGGTACAAAGGTCATTTGATCGAAGCTATATCTTCCGCATTTAATTCCTCATCTTGGAAGGTTAAT
GGAGCTGGGGATCATCTTCTTCGATCTCTCCTTGGAAGTCTGATTCTTTACTATCCTATTGATCAATACAAATGTTTGTC
TCGTCACCCTGCTGCTTCTGCTTTGGAGGAATGGATCAGCACCAAAGCTTCTTCTAAGGATGAGCAGGTGGCGCATTCCA
GGTGGCATGTTCCCACCAAAGAGGAAACTCAGTTTGCCAATGAGCTCTTAGATCTCCATCTTCAGTCAGCGTTAGATGAT
CTTTTGAGTATTTGCCAATCAAACATCCACTCTGATGCAGGAGATGAGAAAACACACCTTAAAGTGACTCTTTTGCGTAT
AGATTCTACATTGCAAGGTGTTTTGTCCTGCCTACCTGATTTCAGGCCATCACCTAGACATGATATGGTTGAAGATCTGC
CGTTCTTTATAGCTGGAGCATCGGGTTCATGTGTTGGCAGTGCTGAAATACGAGAAAAAACTGCTAAAACAATTCATGCA
GCCTGCAAATACTTGTTAGAGAAAAAGTCAGATGACAGCATCTTGTTGATATTAATAATCCGCATAATGGATGCCCTGGG
AAACTATGGCAGTTTGGAGTATGATGAATGGTCAAATCACAGGCAGGCTTGGAAACTGGAATCTGCTGCGATTGTAGAGC
CTCCAGCAAACTTTATTACTGAGTTTAATTCTAAGGGCAAGAGAAGGCCTAGATGGGCACTCATTGATAAAGCGTACATG
CACAACACTTGGAGATCATCACAATCGTCATATCATCTGTTTCGTACAGATGGGAACTTCTCTCCACCAGAAGCCTTGAC
ACTTTTGGTTGATGACCTTTTGACCCTCTGTCTGCACAACTATGAAACTGTTCGAGTGCTTTCTGGAAAATCTTTGCTGA
AACTGTTAAAAAGATGGCCGACATTGCTTTCAAAGTGTGTTCTGTCCCTTACTGAGAACTTGCGAAAGCCGGATGTAGAA
GAGAATGTAGTCCTTGGTTCTTGTGCCATTCTCTCTTCACAGAGTGTTCTCAAGCATTTGACTACTCTTTTTGTCAAATA
TAACATTCACTTTGCGGGGCTGTCGAGAAACATACTTCGCTCATTGGAAAGCCATGTTGAGGGGTCTACTTCTGGAGATC
TTGTTTCTCAGATTGGCTCCATGAGTTTTGATTCTTCCAGCTTGCATTGGCGGTACAACTTGATGGCTAACAGAGTGCTC
CTTCTGTTAGTTATGTCCTCTAGGATTGACCCAAGCTTCTCTTTCAAAATCCTTGATGAAACTGCTGGCCACTTCTTGAA
AAACTTGAAAAGTCAACTTCCTCAGACGAGAATACTGGCGATTTCAGCGTTAAACACCCTACTTAAAGAGTCACCTCATA
AGATGCAAGGCAAGGATCAGCCTTCTGTGTCTTCACAAGAAATTGAAAATGCGAACTCATCCCTTGATTTAGCATTGAGC
CAAATTTTTAGAGAGGAAGGATTCTTCAAGGAGACTTTTGAAAGTCTTTCTCATATTCATGTCACTGACACAGATAGTTC
CTCTAGAGGTAATCACGGAAGTTCATCCTTCCAGAGCATGGCGGACAAGTCGATCACTCGTTTCTATTTTGAATTCTCGG
CTTCATGGCCAAGAACTCCTAGTTGGATATCTTTGTTAGGCAGTGATATATTTTACCCAAGTTTTGCTCGCATCTTCAAG
CGATTAGCACAAGAATGTGGAGTGCCTGTGTTACTGGCACTAAAAAGCCCCTTAGAGGAGTTTTGTAACGCCAAGGAGAG
ACCAAAACAGTGTGTTGCTGCTGAAGCATTAGCAGGTGTACTGCACTCTGATGTTAATGGTCTTCTTGGTGAGTGGGATA
GCTGGATAATGGTTCAGTTGCAGAATGTTATTCTTGGCCAATCAGTAGAATCCATACCGGAATGGGCTGCTTGCATACGT
TATGCTGTCACGGGGAAAGGGAAGCAAGGAACCAAAATTCCTGTCATGAGACAACAAATTTTGGACTGTATAGTGGCACC
ATTACCACCAACTGCGACCACCACTGTTGTTGCAAAGCGGTATGCTTTTCTTTCGGCTGCTCTAATAGAACTATCTCCAC
CAAAGATGCCTGTATCAGAAGTGAAGCTGCATATCGTGCTTCTTGATGAGTTGATCTGTAATATGTCCCATTCCTCGGCA
CAAATAAGGGAAGCTATCGGTGTAATTCTTTCAGTATTATGTTCTAACATTCGGCTGCGGATGTCATATCAACAAGAACA
TCCATCTGAAGAAGGGAGAACAGATGTTGATAGCCAACTTAAGGAGGAAAATTGGTTCAAGTTGATTGGTGCAAAAGCAT
CTGAAGCTGTAAAAAACATTCAACAAGCTAGCATATCAGATAGCTTGGACACTTCAGCAGATGTGGATATGGAAAATGCT
CAATCAAATGGCGACTCTCTTGATGATGTTAAATGGATGGAGACGCTCTTCCATTTCATTATCTCATCTTTCAAATCTGG
AAGGGCTTCGTATCTGCTAGACGTAATTGCGGGATTCCTCTATCCAGTGATATCCTTACAGGAAACATCACATAAAGATC
TATCAATATTGGCTAAGGCAGCCTTTGAGCTGCTGAAATGGCGAGTTTTCCCAGAATCTCATCTACCGAAAGTTATTGGA
GTCATTCTTTCTTCTGCTGATGACTCTAACTGGCGGATAAGATCTTCAACCCTGACATATCTGCGAACTTTTATGTATAG
GCATACTTTCATCCTCTCTCATGAAGATAAACAGAAAATCTGGAAAACGGTGGAAAAGCTCCTTGTTGACAGCCAAGTAG
AGGTACGAGAGCATGCAGCAGCAGTTCTAGCAGGCCTAATGAAAGGAGGAGATGAAGATTTTGCTGCCGATTTTCGTGAT
AGATCCTACACAGAGGCAAACTCCATCCAGAAGAGAAGAAATCGGAGGAAAGCAAGTTCAACTCAGTCCATTGCAGAGGT
GCATGGAGCCGTTCTTGGTTTAGTAGCTTCAGTTTTGTCTGTTCCTTATGACATGCCCAGCTGGCTGCCGGATCATGTGA
CCTTACTGGCTCGTTTCGCGGGTGAACCTACACCTATAAAATCGACTGTGACTAAAGCAGTGGCTGAGTTCCGGCGAACC
CATGCGGATACATGGAACATCCAGAAAGATTCGTTCACTGAAGATCAGCTTGAGATCTTGACGGATACATCTTCCTCTTC
TTCATACTTTGCTTGA