Details for Lyrate rockcress Locus 16039988

Position : sca3 ( 5`- 7538601 .. 7537478 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039988

Protein [Map View]
MKNKASMDATHPPPQLPSLSDLEARMQILRESGFEESQGDDDTFGQRAEWFYQRRPLLLKLCLDLYNGYITLLGRSSHQT
RLKPTTSIPNQLLQDDDDCISDLDSVSEISSEVESTLSFQQMQDSAAVSEKVEELVSQLVTASLDKEILKHELLHKEQQF
HEASKTIELLKKFVMLLEMEKEVAVEENANLGYKLTSLLEENRELATEALFMKNEAVGLARCVLKMRDDHFHKVCILQNR
IYSLQASRNSEPVSDKVSSGCFGLNKHKTKKKKENKTEEKTGFKWLKKLNNINLFTKRSLNPSAAAPSCCTFDMPN*

DNA
ATGAAGAACAAAGCATCCATGGACGCTACTCATCCTCCACCGCAGTTGCCATCTCTCTCTGACCTTGAAGCTCGGATGCA
AATCCTGCGCGAGTCTGGTTTTGAAGAAAGCCAAGGAGATGATGATACATTTGGTCAACGAGCTGAATGGTTTTACCAGA
GACGACCTCTGCTTCTCAAGCTTTGTCTTGACCTGTACAACGGCTACATCACTCTCTTGGGTCGTTCTTCTCATCAGACC
AGACTTAAACCCACAACTTCTATTCCCAACCAGCTTCTCCAAGATGATGATGACTGCATTTCAGACCTTGATTCCGTTAG
TGAGATCAGTTCCGAAGTCGAAAGCACCTTATCCTTTCAACAGATGCAAGATTCTGCTGCGGTTTCAGAGAAAGTTGAGG
AGCTGGTATCCCAACTTGTGACAGCAAGCTTGGACAAAGAGATACTGAAACACGAGTTACTTCACAAGGAGCAACAGTTT
CATGAAGCCTCCAAGACTATAGAGCTGTTGAAGAAGTTTGTCATGTTGCTGGAGATGGAGAAAGAAGTGGCTGTGGAGGA
AAACGCTAATCTTGGCTACAAACTCACTTCTCTTTTGGAGGAGAACAGAGAGCTAGCGACTGAGGCGTTGTTCATGAAGA
ATGAGGCTGTTGGGCTCGCTAGGTGTGTGCTTAAGATGAGAGATGATCATTTTCACAAGGTCTGCATTCTCCAGAACCGC
ATCTACTCACTTCAGGCATCCAGGAACTCAGAGCCTGTCTCTGATAAGGTCTCATCCGGATGCTTTGGCCTGAATAAGCA
TAAGACCAAAAAGAAGAAGGAGAACAAAACCGAAGAGAAGACTGGATTCAAGTGGTTGAAGAAGCTGAACAACATTAACC
TGTTTACAAAGCGCAGCCTTAACCCATCAGCTGCTGCTCCTTCATGCTGCACTTTCGACATGCCTAATTAG