Details for Lyrate rockcress Locus 16039983

Position : sca3 ( 5`- 7297714 .. 7298546 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039983

Protein [Map View]
MGMSLDFDVDLEKGIIDCDNVYTKSPEKPMSPDNKPVITGEESVGSLENDATPVQCGINKPGWGRSDRKEKRKKSASKPP
RPPRGPSLDAADQKLIREIAELAMLKRARVERMRALKKSRAAKAASAASSLGNVLATLFTAIFFFVLVFQGLSPRAAGSS
GKSHVVVAGKANGGFVPVQYAGNPSASEPDGGYTGPVLAQRPNLLKPVSGLENEKKSSQ*

DNA
ATGGGAATGAGTCTCGATTTCGATGTTGATCTTGAGAAAGGAATCATAGATTGCGACAATGTTTATACTAAATCACCGGA
GAAGCCGATGTCTCCTGATAACAAACCGGTTATTACCGGAGAAGAAAGTGTTGGTTCGTTAGAGAATGATGCAACTCCGG
TTCAATGTGGAATCAATAAACCGGGATGGGGGAGAAGCGATCGGAAGGAGAAACGGAAGAAATCTGCGTCGAAGCCTCCA
CGACCGCCGCGTGGACCGTCGCTAGATGCGGCGGATCAGAAACTTATTAGAGAGATCGCTGAATTGGCGATGTTGAAACG
CGCGAGAGTCGAACGTATGAGAGCTTTGAAGAAATCAAGAGCTGCTAAAGCTGCGTCTGCGGCTTCTTCTTTAGGCAATG
TCTTGGCCACTCTTTTCACCGCTATTTTCTTCTTTGTTCTTGTTTTTCAAGGATTGTCACCGAGAGCAGCTGGTAGCTCC
GGTAAATCTCACGTAGTAGTCGCCGGCAAAGCCAATGGTGGTTTTGTTCCGGTTCAATATGCGGGAAATCCGTCTGCGAG
CGAACCGGATGGAGGTTATACCGGACCGGTTTTAGCACAGAGACCAAATTTACTAAAACCGGTGTCCGGTTTGGAGAATG
AAAAGAAGAGTTCACAGTGA