Details for Lyrate rockcress Locus 16039959

Position : sca3 ( 5`- 5189866 .. 5188260 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16039959

Protein [Map View]
MAGNGMHTLGRVKVSDLAPSEGLPSDSYKLAVTTLSQSLAQYSAAIIQFPPSDGALLRSGLDSARLYFHQRDSYPATNNM
IHTNDSQEWCKTSGYYADPQSWQESYEYRPGLTPTEPTNSIDFPPAGLPDIFALLGKAARVVLDAIGFYLNLRSCPFTEI
LDNVPLRNGEISSSVLSVCCYARPSFHGAQHHTLTEDEQLILYADHDHQLDKSLISFVKSDKAGFHIRDMHGQWILVDVD
LGPQEAVVYPGLALYQATAGYVSPAVHRTDLNSLQGSIEGRFSLAFKLMPKSMTNLSCSEMRAAGHGVEAQFQLPVSVDD
FMQRSHSNDELFNRQTLQSFSIPQSQDGSMKQLKKRRKSDSRCKPLPPSKRLRLEAQRVLKERVQEIADKKGIKLRFCNL
KECENNHNVMNSPCANIRREIGWPHGVPFVHPHDLPNKAKIGFLETYEPGWSETHDMELSLSETAQGNQHVTNCNQSFTQ
*

DNA
ATGGCAGGAAATGGAATGCATACACTGGGTCGTGTCAAGGTTTCTGATTTAGCTCCCAGTGAAGGTCTACCTTCTGATTC
TTACAAGTTAGCAGTGACTACATTGTCTCAGTCTCTGGCACAGTACTCTGCAGCCATCATTCAGTTTCCTCCTAGCGATG
GAGCCCTCCTTAGATCCGGTCTTGATTCTGCTCGGCTCTATTTTCACCAGAGAGATTCATATCCAGCCACTAATAATATG
ATCCACACAAATGATTCACAAGAATGGTGCAAGACTTCTGGCTACTATGCAGATCCTCAGTCGTGGCAAGAGAGTTACGA
GTATAGACCCGGTTTGACCCCTACCGAGCCAACCAATTCTATAGATTTCCCTCCAGCTGGTTTGCCTGATATCTTTGCTT
TACTAGGAAAAGCTGCTCGTGTAGTTCTTGATGCCATTGGTTTCTATTTGAACTTGAGAAGCTGTCCATTTACTGAGATT
CTCGATAATGTCCCTTTGAGGAATGGTGAGATATCGTCCTCTGTGTTATCTGTTTGCTGTTATGCTAGGCCGTCATTTCA
TGGAGCACAGCACCATACCCTAACAGAAGACGAGCAGCTTATCCTGTATGCAGACCATGATCACCAACTTGACAAGAGTC
TGATCTCATTTGTGAAATCAGATAAGGCGGGGTTCCACATCAGGGACATGCACGGGCAATGGATTTTGGTTGATGTGGAT
CTTGGTCCTCAAGAGGCTGTTGTGTACCCAGGGCTAGCTCTTTACCAGGCTACAGCTGGGTATGTGAGTCCCGCAGTGCA
CAGAACCGATTTAAACAGTCTGCAAGGAAGTATAGAAGGGAGGTTCTCCTTGGCCTTCAAACTCATGCCAAAATCAATGA
CCAATCTGAGTTGCTCGGAGATGAGAGCCGCAGGTCATGGTGTTGAAGCTCAGTTTCAGCTCCCGGTTTCAGTCGATGAT
TTCATGCAGAGATCTCACTCAAATGATGAACTCTTTAACAGACAGACTTTGCAAAGCTTCAGCATCCCTCAATCCCAGGA
TGGATCAATGAAACAGCTGAAAAAGCGGAGGAAGAGCGATTCTAGATGCAAACCACTACCACCTTCAAAGCGGCTGAGGT
TAGAAGCACAGAGAGTTCTCAAGGAACGAGTTCAGGAAATTGCAGATAAAAAAGGAATCAAACTAAGATTCTGCAATCTC
AAGGAGTGTGAGAATAACCACAATGTAATGAACAGCCCTTGTGCGAATATAAGAAGGGAGATCGGGTGGCCACACGGAGT
TCCATTTGTTCATCCTCACGACCTACCCAATAAAGCTAAAATCGGTTTCCTTGAGACATATGAGCCAGGATGGTCCGAAA
CACATGACATGGAGCTCAGTCTATCTGAAACCGCTCAGGGAAACCAACATGTGACTAACTGTAACCAATCATTCACCCAA
TAG