Details for Lyrate rockcress Locus 16039945

Position : sca3 ( 5`- 498441 .. 500595 -3` )
Annotation : [B2G] proteasome family protein
External links : CoGe
PGDD synteny : 16039945

Protein [Map View]
MTTIVPTSEEDPFLAVVRFTSQLAWADAGPEAAEPEITRLCREAEESIVKEKWLELSTLMVTSAELVSSKISEKDLECTY
TIICSIVKKVESPEDVLAIVKAIASEVAQQPSDKASLRLKILFNLYNLVDHPYARFQVYMKALTLAVDGKVTEYIVSSFK
KIDNFLKEWNIDIKDQRELFLAIANVLKENKSLVNESLKFLTKYLATFSNEDTQVLDEAKEEAVRAVIEFVKASTIFQCD
LLDLPAVAQLEKDAKYAPVYQLLKIFLTQRLNAYTEFQNANPEFLQSYGLADEDCVSKMRLLSLVDLASDESGKIPYASI
KDALQVNEEDVELWIVKAITAKLIDCKMDQMNQVVIVSRSSEREFGTKQWQSLRTKLATWKDNISNIITTIESNKVTEEG
SQASSSSAAAIQGLSVR*

DNA
ATGACGACGATCGTTCCCACTTCCGAAGAAGATCCCTTTCTCGCTGTTGTCCGATTCACTTCCCAGCTCGCCTGGGCCGA
TGCTGGTCCCGAGGCTGCAGAGCCTGAAATTACCAGGCTATGTAGAGAGGCTGAGGAGTCAATAGTTAAAGAGAAGTGGC
TGGAATTGTCTACGTTAATGGTAACTTCAGCTGAATTGGTATCATCCAAGATTTCTGAGAAAGATCTCGAGTGTACCTAC
ACCATCATTTGCAGCATTGTCAAGAAGGTTGAAAGCCCTGAGGATGTTCTTGCAATTGTGAAAGCTATAGCTTCCGAGGT
TGCTCAACAACCGAGTGACAAAGCTTCACTTCGTTTGAAGATCCTCTTTAATCTCTATAACCTGGTGGACCATCCGTATG
CTCGTTTTCAAGTATACATGAAAGCTCTTACACTAGCTGTTGATGGGAAGGTTACTGAGTACATAGTTTCTTCTTTTAAG
AAGATCGATAACTTCCTGAAAGAGTGGAATATTGACATTAAGGATCAGAGGGAACTCTTTCTTGCCATTGCCAATGTGCT
GAAAGAAAACAAAAGCTTGGTGAATGAATCCCTTAAGTTCTTGACGAAGTACCTAGCAACTTTCTCCAATGAGGATACTC
AGGTCCTGGATGAAGCCAAGGAGGAGGCTGTGCGTGCAGTTATCGAGTTTGTCAAAGCTTCCACTATTTTTCAGTGTGAT
TTATTGGACTTGCCAGCCGTAGCACAATTGGAAAAGGATGCTAAATATGCTCCGGTTTACCAGCTTCTGAAGATCTTTCT
TACTCAGAGACTAAATGCCTACACGGAATTCCAAAATGCAAATCCGGAATTTCTGCAAAGCTATGGACTTGCTGATGAAG
ATTGTGTTTCGAAGATGAGATTGTTGTCACTAGTGGACTTGGCCTCAGATGAATCTGGCAAAATACCTTACGCCTCAATT
AAAGACGCTCTTCAGGTAAATGAAGAAGATGTTGAGTTATGGATCGTGAAGGCAATAACTGCAAAATTGATTGATTGTAA
GATGGATCAGATGAACCAAGTTGTAATTGTCAGCCGCTCTTCCGAACGTGAATTTGGGACAAAGCAATGGCAATCTCTCC
GAACAAAGCTTGCGACTTGGAAGGACAACATTTCAAACATAATAACTACAATCGAATCGAATAAGGTAACCGAGGAAGGT
TCTCAGGCATCATCATCATCTGCTGCAGCAATTCAAGGCTTGTCTGTTCGTTGA