Details for Lyrate rockcress Locus 16039898

Position : sca3 ( 5`- 4337875 .. 4339975 -3` )
Annotation : [B2G] bzip transcription factor family protein
External links : CoGe
PGDD synteny : 16039898

Protein [Map View]
MTESTFVIAPPPEIPNLNPSMFSESDMISIPPLDPLFLSDSDPISMDAPISDLDFLLDDENGDFADFDFSFENSDDFFDF
DLAEPAVVIPEEIGNSRSNLDSSENRSGDGGLEGRSDSVHSQVSSQGSKTFVSDTVDALSSPESSNHQKSSVSKRKNENG
DSSGELRSCKYQKSDDKSVATNNEGDDDDKRKLIRQIRNRESAQLSRLRKKQQTEELERKVKSMNATIAELNGKIAYVMA
ENVALRQQMAVASGAPPMNPYMAAPPLPYQWMPYPPYPVRGYGSQTPLVPIPKLNPKPVSSCRPKKADSKKNEGKSKLKK
VASISFIGILFFMFLFGTLVPFMNVNYGGEGGSFGGLSKYDGHRYYDEHKGKVLMVGDGSDVRRESGISEGNIHSSRIIH
GERDSCGGVDYNGHPKVEGRSSSLSNASDPLFASLYVPRNDGLVKIDGNLIIHSVLASEKATALGKKNITETVKSKEPDL
TMPGALSSAIAVPEVRGNAAMLPHSTALSSEGKRLHQWFHEGGSGTLMDYSMCTEVFQFDIAPGAIVPSSVSNISAEHLQ
NVTTHGKRMKNRRILEGLPVSLVASELNITGTQPNKDAQNKTFHGNTNKPTSSSSMVVSVLLDPREVVDSENDRVVPPNP
KSLSRIFVVVLLDSVKYVTYSCVLPRSGLHLVAT*

DNA
ATGACGGAATCAACATTCGTTATTGCTCCTCCGCCGGAGATACCTAATCTGAACCCTAGCATGTTTTCGGAATCCGATAT
GATTTCTATTCCGCCGCTAGATCCTCTTTTCCTATCTGATTCTGATCCGATTTCAATGGATGCGCCGATCTCCGATCTCG
ACTTCTTACTCGACGATGAGAACGGAGATTTTGCTGATTTCGATTTCTCGTTTGAGAATTCTGATGATTTCTTCGATTTC
GATTTGGCGGAGCCCGCGGTGGTGATCCCTGAGGAGATCGGGAATAGTCGTTCGAATTTGGACTCATCGGAGAACAGAAG
CGGCGATGGAGGTTTAGAAGGACGATCTGATTCTGTTCATTCTCAGGTTTCATCTCAAGGCTCAAAGACTTTTGTGTCCG
ACACCGTTGACGCATTATCCTCCCCTGAATCAAGCAATCACCAGAAATCTTCTGTCAGCAAGAGGAAGAATGAAAATGGA
GACTCCAGTGGCGAATTAAGGAGCTGCAAGTACCAAAAGTCTGATGATAAATCAGTCGCTACGAACAACGAAGGTGATGA
TGACGACAAGAGGAAGTTGATAAGGCAGATTAGGAACCGTGAAAGTGCTCAGCTTTCGAGGTTGAGGAAGAAGCAACAAA
CTGAGGAGCTTGAAAGAAAAGTGAAGAGTATGAATGCCACCATTGCTGAATTGAATGGTAAGATTGCTTATGTTATGGCT
GAGAATGTAGCTTTAAGGCAACAAATGGCTGTTGCTTCTGGTGCGCCTCCTATGAATCCTTATATGGCTGCACCGCCTTT
ACCGTATCAATGGATGCCCTATCCGCCTTATCCTGTTAGGGGCTATGGATCACAGACTCCATTGGTTCCCATTCCCAAGT
TAAATCCTAAGCCTGTCTCGAGTTGTAGACCGAAGAAGGCAGATAGTAAGAAGAATGAGGGCAAAAGTAAGCTCAAGAAG
GTTGCTAGTATTAGTTTTATTGGAATTCTCTTCTTTATGTTCTTGTTTGGTACATTGGTTCCGTTTATGAATGTAAATTA
TGGAGGAGAAGGTGGAAGCTTTGGCGGTTTGTCTAAATATGATGGTCACCGGTATTACGATGAACATAAGGGGAAGGTTC
TAATGGTCGGGGATGGTTCTGATGTTAGAAGAGAAAGTGGGATTTCTGAAGGAAATATACATTCTAGTAGGATAATTCAT
GGTGAGAGAGATAGTTGTGGAGGAGTAGATTATAATGGTCATCCGAAAGTAGAAGGACGATCAAGTTCATTGAGCAATGC
GAGTGATCCTCTGTTTGCTTCACTCTATGTCCCAAGAAACGATGGGCTTGTGAAGATCGATGGGAACTTGATAATTCACT
CTGTTTTGGCGAGCGAGAAAGCAACGGCTCTAGGGAAGAAGAATATCACTGAAACAGTCAAAAGTAAAGAACCGGATTTG
ACCATGCCTGGTGCACTGTCTTCTGCTATAGCTGTTCCGGAGGTAAGAGGAAATGCAGCAATGCTTCCACATTCAACGGC
TCTCTCTTCTGAAGGGAAAAGACTTCACCAGTGGTTTCATGAAGGTGGCTCAGGGACACTAATGGATTACAGCATGTGCA
CCGAGGTTTTCCAGTTTGATATTGCTCCCGGTGCGATAGTCCCATCATCAGTCTCAAACATTTCTGCGGAGCATCTCCAA
AATGTCACTACCCACGGCAAGAGAATGAAGAACAGGAGAATTCTCGAGGGACTTCCTGTTTCACTTGTGGCGTCTGAGCT
CAATATCACCGGAACCCAGCCGAACAAAGACGCTCAAAACAAGACCTTTCATGGAAACACTAACAAACCCACATCATCAT
CCTCCATGGTTGTCTCAGTGTTGCTTGATCCAAGAGAGGTCGTCGACTCTGAAAATGACAGAGTGGTGCCCCCAAACCCA
AAATCACTTTCCCGGATCTTTGTGGTTGTACTTCTTGACAGTGTCAAGTACGTTACCTACTCATGCGTTCTTCCTCGGTC
GGGTCTCCATCTCGTAGCCACCTGA